BLASTX 7.6.2 Query= RU01986 /QuerySize=547 (546 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|P81760|TL17_ARATH Thylakoid lumenal 17.4 kDa protein, chlorop... 177 4e-044 >sp|P81760|TL17_ARATH Thylakoid lumenal 17.4 kDa protein, chloroplastic OS=Arabidopsis thaliana GN=At5g53490 PE=1 SV=2 Length = 236 Score = 177 bits (448), Expect = 4e-044 Identities = 89/112 (79%), Positives = 99/112 (88%) Frame = -3 Query: 544 NLKGKSLAAALMSEAKFDGADMTEVVMSKAYAAGASFKGTNFSNAVLDRVNFEKANLQGA 365 NLKGK+L+AALM AKFDGADMTEVVMSKAYA ASFKG NF+NAV+DRVNF K+NL+GA Sbjct: 125 NLKGKTLSAALMVGAKFDGADMTEVVMSKAYAVEASFKGVNFTNAVIDRVNFGKSNLKGA 184 Query: 364 LFINTVLSGSTFNDAQLDGAVFEDTIIGYIDLQKLCRNTSINEEGRDVLGCR 209 +F NTVLSGSTF +A L+ VFEDTIIGYIDLQK+CRN SINEEGR VLGCR Sbjct: 185 VFRNTVLSGSTFEEANLEDVVFEDTIIGYIDLQKICRNESINEEGRLVLGCR 236 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,407,642,047 Number of Sequences: 462764 Number of Extensions: 3407642047 Number of Successful Extensions: 34563130 Number of sequences better than 0.0: 0 |