BLASTX 7.6.2 Query= RU02092 /QuerySize=922 (921 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|P20144|WUN1_SOLTU Wound-induced protein 1 OS=Solanum tuberosu... 101 7e-021 >sp|P20144|WUN1_SOLTU Wound-induced protein 1 OS=Solanum tuberosum GN=WUN1 PE=2 SV=1 Length = 105 Score = 101 bits (251), Expect = 7e-021 Identities = 49/75 (65%), Positives = 59/75 (78%) Frame = -3 Query: 652 RLLTGCDNKNDASFQFNPQSICSVGPVVLVEGCDPEQEISWVHAWTVTDGIITQVREYFN 473 ++LTG ++ASFQF ++I G VVLVEGCDP + I+WVHAWTVTDG+ITQVREYFN Sbjct: 2 QILTGTAKFDNASFQFLHKTIDVFGSVVLVEGCDPTRSITWVHAWTVTDGVITQVREYFN 61 Query: 472 TSLTVTRLGNSTSSA 428 TSLTVTR G S S+ Sbjct: 62 TSLTVTRFGKSDISS 76 Score = 56 bits (133), Expect = 3e-007 Identities = 35/66 (53%), Positives = 43/66 (65%), Gaps = 5/66 (7%) Frame = -3 Query: 499 ITQVREYFNTSLTVTRLGN--STSSAKPKFSKS-TSEITSYHCPSVWESS--NRVGKSVP 335 IT V + T +T++ +TS +F KS S IT+ HCPSVWESS NRVGKSVP Sbjct: 40 ITWVHAWTVTDGVITQVREYFNTSLTVTRFGKSDISSITTLHCPSVWESSLPNRVGKSVP 99 Query: 334 GLVLAI 317 GLVLA+ Sbjct: 100 GLVLAL 105 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,407,642,047 Number of Sequences: 462764 Number of Extensions: 3407642047 Number of Successful Extensions: 34563130 Number of sequences better than 0.0: 0 |