BLASTX 7.6.2 Query= RU02152 /QuerySize=379 (378 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9ZWQ8|PAP_CITUN Plastid-lipid-associated protein, chloroplas... 61 1e-009 sp|Q96398|CHRC_CUCSA Chromoplast-specific carotenoid-associated ... 61 1e-009 >sp|Q9ZWQ8|PAP_CITUN Plastid-lipid-associated protein, chloroplastic OS=Citrus unshiu GN=PAP PE=2 SV=1 Length = 323 Score = 61 bits (147), Expect = 1e-009 Identities = 36/78 (46%), Positives = 45/78 (57%), Gaps = 4/78 (5%) Frame = +1 Query: 133 MAFVSQLNQFPCKTLSPTPRHPRLTSKPSTFAPNSIGLATPKLK---LSNPEYPQAIRPA 303 MA +SQ NQFPCKTLS P H + TSKPS NS+ ++ K LS + +A RP Sbjct: 1 MASISQTNQFPCKTLSQNPPHNQFTSKPSILPLNSVRISRSLAKKSFLSIQGFTRA-RPL 59 Query: 304 TRIRAVDEDESAPETSEE 357 RA D+DE PE +E Sbjct: 60 VLTRAADDDEWGPEKEKE 77 >sp|Q96398|CHRC_CUCSA Chromoplast-specific carotenoid-associated protein, chromoplast OS=Cucumis sativus GN=CHRC PE=1 SV=1 Length = 322 Score = 61 bits (146), Expect = 1e-009 Identities = 36/75 (48%), Positives = 45/75 (60%), Gaps = 3/75 (4%) Frame = +1 Query: 133 MAFVSQLNQFPCKTLSPTPRHPRLTSKPSTFAPNSIGLATPKLKLSNPEYPQAIRPATRI 312 MAFVSQ NQ PCKTL+ P P+LTSKPS F SIG AT + ++RPA ++ Sbjct: 1 MAFVSQFNQLPCKTLALNPPQPQLTSKPSVFPIASIG-ATARAAAGKSLI--SVRPAFKV 57 Query: 313 RAVDEDESAPETSEE 357 RAV D+ E +E Sbjct: 58 RAVLNDDEWGEDKDE 72 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,407,642,047 Number of Sequences: 462764 Number of Extensions: 3407642047 Number of Successful Extensions: 34563130 Number of sequences better than 0.0: 0 |