BLASTX 7.6.2 Query= RU02327 /QuerySize=388 (387 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q39173|P2_ARATH Probable NADP-dependent oxidoreductase P2 OS=... 68 1e-011 sp|Q39172|P1_ARATH Probable NADP-dependent oxidoreductase P1 OS=... 64 1e-010 sp|Q9C0Y6|YKM8_SCHPO Zinc-type alcohol dehydrogenase-like protei... 51 1e-006 sp|P76113|YNCB_ECOLI Putative NADP-dependent oxidoreductase yncB... 49 4e-006 >sp|Q39173|P2_ARATH Probable NADP-dependent oxidoreductase P2 OS=Arabidopsis thaliana GN=P2 PE=2 SV=2 Length = 343 Score = 68 bits (164), Expect = 1e-011 Identities = 30/51 (58%), Positives = 40/51 (78%) Frame = -3 Query: 385 PRFLEDVISLYKQGKIVYIEDMNEGLESAPSAFVGLFSGRNIGKQVIRVAR 233 P+FLE V+ K+GKI Y+ED+ +GLE AP A VGLF G+N+GKQV+ +AR Sbjct: 292 PKFLELVLPRIKEGKITYVEDVADGLEKAPEALVGLFHGKNVGKQVVVIAR 342 >sp|Q39172|P1_ARATH Probable NADP-dependent oxidoreductase P1 OS=Arabidopsis thaliana GN=P1 PE=1 SV=1 Length = 345 Score = 64 bits (155), Expect = 1e-010 Identities = 29/50 (58%), Positives = 39/50 (78%) Frame = -3 Query: 382 RFLEDVISLYKQGKIVYIEDMNEGLESAPSAFVGLFSGRNIGKQVIRVAR 233 +FLE V+ ++GKI Y+ED+ +GLE AP A VGLF G+N+GKQV+ VAR Sbjct: 295 KFLEFVLPHIREGKITYVEDVADGLEKAPEALVGLFHGKNVGKQVVVVAR 344 >sp|Q9C0Y6|YKM8_SCHPO Zinc-type alcohol dehydrogenase-like protein PB24D3.08c OS=Schizosaccharomyces pombe GN=SPAPB24D3.08c PE=2 SV=1 Length = 349 Score = 51 bits (121), Expect = 1e-006 Identities = 21/49 (42%), Positives = 35/49 (71%) Frame = -3 Query: 382 RFLEDVISLYKQGKIVYIEDMNEGLESAPSAFVGLFSGRNIGKQVIRVA 236 ++ E++ L +GKI Y D+ +GLESAP AF+G+ G+N GK ++++A Sbjct: 299 QYFEEMPKLIAEGKIKYKCDVYDGLESAPEAFIGMLQGKNSGKTIVKIA 347 >sp|P76113|YNCB_ECOLI Putative NADP-dependent oxidoreductase yncB OS=Escherichia coli (strain K12) GN=yncB PE=3 SV=2 Length = 353 Score = 49 bits (116), Expect = 4e-006 Identities = 22/39 (56%), Positives = 29/39 (74%) Frame = -3 Query: 352 KQGKIVYIEDMNEGLESAPSAFVGLFSGRNIGKQVIRVA 236 K+ KI Y E++ +GLE+AP F+GL G+N GK VIRVA Sbjct: 312 KEDKIHYREEITDGLENAPQTFIGLLKGKNFGKVVIRVA 350 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,748,393,089 Number of Sequences: 462764 Number of Extensions: 3748393089 Number of Successful Extensions: 40737119 Number of sequences better than 0.0: 0 |