BLASTX 7.6.2 Query= RU03279 /QuerySize=265 (264 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9SX77|UMP6_ARATH Uncharacterized protein At1g47420, mitochon... 64 2e-010 >sp|Q9SX77|UMP6_ARATH Uncharacterized protein At1g47420, mitochondrial OS=Arabidopsis thaliana GN=At1g47420 PE=1 SV=1 Length = 257 Score = 64 bits (153), Expect = 2e-010 Identities = 33/55 (60%), Positives = 41/55 (74%) Frame = +1 Query: 73 MGTLGRAIYTVGFWIRETGQAVDRLGSRLQGSYYFKEQLSRHRTLMNVFDKAPVV 237 MGTLGRAI+TVG IR T QA R+GS LQGS++ ++ LSRHRTL+ V A V+ Sbjct: 1 MGTLGRAIHTVGNRIRGTAQAQARVGSLLQGSHHIEKHLSRHRTLITVAPNASVI 55 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,073,084,167 Number of Sequences: 462764 Number of Extensions: 6073084167 Number of Successful Extensions: 56121479 Number of sequences better than 0.0: 0 |