BLASTX 7.6.2 Query= RU04212 /QuerySize=657 (656 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|A6Q0K5|CP12_CHLRE Calvin cycle protein CP12 OS=Chlamydomonas ... 84 8e-016 >sp|A6Q0K5|CP12_CHLRE Calvin cycle protein CP12 OS=Chlamydomonas reinhardtii GN=cp12 PE=1 SV=1 Length = 80 Score = 84 bits (205), Expect = 8e-016 Identities = 39/74 (52%), Positives = 53/74 (71%), Gaps = 5/74 (6%) Frame = +3 Query: 246 LSEKVQESIKEAEQACSEDPASGECVAAWDEVEELSAAASHKRDSEKN----KDPLETYC 413 L++KVQ+++KEAE AC++ S +C AWD VEELSAA SHK+D+ K DPLE +C Sbjct: 8 LNKKVQDAVKEAEDACAKG-TSADCAVAWDTVEELSAAVSHKKDAVKADVTLTDPLEAFC 66 Query: 414 SDNPETDECRTYDN 455 D P+ DECR Y++ Sbjct: 67 KDAPDADECRVYED 80 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,423,807,684 Number of Sequences: 462764 Number of Extensions: 6423807684 Number of Successful Extensions: 63594173 Number of sequences better than 0.0: 0 |