BLASTX 7.6.2 Query= RU06540 /QuerySize=1110 (1109 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q8TGM7|ART2_YEAST Uncharacterized protein ART2 OS=Saccharomyc... 64 2e-009 sp|Q3E811|YL62A_YEAST Uncharacterized protein YLR162W-A OS=Sacch... 63 3e-009 >sp|Q8TGM7|ART2_YEAST Uncharacterized protein ART2 OS=Saccharomyces cerevisiae GN=ART2 PE=2 SV=1 Length = 61 Score = 64 bits (153), Expect = 2e-009 Identities = 35/57 (61%) Frame = +1 Query: 640 VRIRTGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPKLPT*QCLPPGSAR 810 V I T NQNQ FYPFV EISVL E LGHLRY LTDVPPQP P P R Sbjct: 2 VCIHTENQNQGGFYPFVLLEISVLHEPPLGHLRYRLTDVPPQPNSPPDNVFNPDQPR 58 >sp|Q3E811|YL62A_YEAST Uncharacterized protein YLR162W-A OS=Saccharomyces cerevisiae GN=YLR162W-A PE=2 SV=1 Length = 62 Score = 63 bits (152), Expect = 3e-009 Identities = 33/46 (71%) Frame = +1 Query: 640 VRIRTGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPKLP 777 V I T NQNQ FYPFV EISVL E LGHLRY LTDVPPQP P Sbjct: 2 VCIHTENQNQGDFYPFVLLEISVLHESPLGHLRYRLTDVPPQPNSP 47 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,512,467,266 Number of Sequences: 462764 Number of Extensions: 10512467266 Number of Successful Extensions: 115616997 Number of sequences better than 0.0: 0 |