BLASTX 7.6.2 Query= RU07619 /QuerySize=616 (615 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|O04136|KNAP3_MALDO Homeobox protein knotted-1-like 3 OS=Malus... 85 3e-016 >sp|O04136|KNAP3_MALDO Homeobox protein knotted-1-like 3 OS=Malus domestica PE=2 SV=1 Length = 427 Score = 85 bits (209), Expect = 3e-016 Identities = 42/62 (67%), Positives = 44/62 (70%), Gaps = 4/62 (6%) Frame = +1 Query: 214 MAYHNHLSGDLPLHHFTDXXXXXXXXXXXFMTDQPDPNSKSTEPHHHPFQTAPNWLNSAL 393 MAYHNHLS DLPLHHFTD + +DQPDPNSK EP HH FQ APNWLNSAL Sbjct: 1 MAYHNHLSQDLPLHHFTD---QTHHQHQQYQSDQPDPNSKPPEP-HHSFQPAPNWLNSAL 56 Query: 394 LR 399 LR Sbjct: 57 LR 58 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,513,639,154 Number of Sequences: 462764 Number of Extensions: 12513639154 Number of Successful Extensions: 124453114 Number of sequences better than 0.0: 0 |