BLASTX 7.6.2 Query= RU08863 /QuerySize=339 (338 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q6DR20|FB110_ARATH F-box protein At2g17036 OS=Arabidopsis tha... 48 1e-005 >sp|Q6DR20|FB110_ARATH F-box protein At2g17036 OS=Arabidopsis thaliana GN=At2g17036 PE=2 SV=1 Length = 404 Score = 48 bits (113), Expect = 1e-005 Identities = 20/37 (54%), Positives = 27/37 (72%) Frame = -1 Query: 179 LQWCDLPKELWQMIGKFLETRVDVLRFRSVCSLWRSA 69 + W LPK+L +I K LE+ D+++FRSVCS WRSA Sbjct: 2 MDWATLPKDLLDLISKCLESSFDLIQFRSVCSSWRSA 38 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,870,915,803 Number of Sequences: 462764 Number of Extensions: 12870915803 Number of Successful Extensions: 130886803 Number of sequences better than 0.0: 0 |