BLASTX 7.6.2 Query= RU09915 /QuerySize=585 (584 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9SY02|PP301_ARATH Pentatricopeptide repeat-containing protei... 64 7e-010 sp|Q9FI80|PP425_ARATH Pentatricopeptide repeat-containing protei... 50 8e-006 >sp|Q9SY02|PP301_ARATH Pentatricopeptide repeat-containing protein At4g02750 OS=Arabidopsis thaliana GN=PCMP-H24 PE=2 SV=1 Length = 781 Score = 64 bits (153), Expect = 7e-010 Identities = 30/51 (58%), Positives = 39/51 (76%) Frame = -3 Query: 498 DSEVVKFNMEISTQMRNGQCEEALRLFNAMGWRSSVSYNAMISGYLANGKF 346 DS++ ++N+ IS+ MR G+C EALR+F M SSVSYN MISGYL NG+F Sbjct: 61 DSDIKEWNVAISSYMRTGRCNEALRVFKRMPRWSSVSYNGMISGYLRNGEF 111 >sp|Q9FI80|PP425_ARATH Pentatricopeptide repeat-containing protein At5g48910 OS=Arabidopsis thaliana GN=PCMP-H38 PE=2 SV=1 Length = 646 Score = 50 bits (118), Expect = 8e-006 Identities = 26/51 (50%), Positives = 32/51 (62%) Frame = -3 Query: 498 DSEVVKFNMEISTQMRNGQCEEALRLFNAMGWRSSVSYNAMISGYLANGKF 346 D E+V +N+ I MR G C+ A LF+ M RS VS+N MISGY NG F Sbjct: 205 DGEIVLWNVMIDGYMRLGDCKAARMLFDKMRQRSVVSWNTMISGYSLNGFF 255 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,192,140,658 Number of Sequences: 462764 Number of Extensions: 15192140658 Number of Successful Extensions: 146257600 Number of sequences better than 0.0: 0 |