BLASTX 7.6.2 Query= RU09995 /QuerySize=362 (361 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q96M96|FGD4_HUMAN FYVE, RhoGEF and PH domain-containing prote... 53 4e-007 sp|Q7Z6J4|FGD2_HUMAN FYVE, RhoGEF and PH domain-containing prote... 52 5e-007 sp|Q8BY35|FGD2_MOUSE FYVE, RhoGEF and PH domain-containing prote... 52 5e-007 sp|Q91ZT5|FGD4_MOUSE FYVE, RhoGEF and PH domain-containing prote... 49 5e-006 sp|O88387|FGD4_RAT FYVE, RhoGEF and PH domain-containing protein... 49 5e-006 sp|Q9HCC9|ZFY28_HUMAN Zinc finger FYVE domain-containing protein... 49 7e-006 >sp|Q96M96|FGD4_HUMAN FYVE, RhoGEF and PH domain-containing protein 4 OS=Homo sapiens GN=FGD4 PE=1 SV=2 Length = 766 Score = 53 bits (125), Expect = 4e-007 Identities = 23/53 (43%), Positives = 31/53 (58%), Gaps = 4/53 (7%) Frame = -1 Query: 148 VAFNYSAYKEILEAE----PPEWLPDSSSIVCMQCTSPFTALTRGRHHCRFCG 2 +A + + E+ AE P W+ D+ +CM+C PF ALTR RHHCR CG Sbjct: 534 IAKDNDIHSEVSTAELGKRAPRWIRDNEVTMCMKCKEPFNALTRRRHHCRACG 586 >sp|Q7Z6J4|FGD2_HUMAN FYVE, RhoGEF and PH domain-containing protein 2 OS=Homo sapiens GN=FGD2 PE=2 SV=1 Length = 655 Score = 52 bits (124), Expect = 5e-007 Identities = 21/40 (52%), Positives = 25/40 (62%) Frame = -1 Query: 121 EILEAEPPEWLPDSSSIVCMQCTSPFTALTRGRHHCRFCG 2 E L P+W+ D +CM+C PF ALTR RHHCR CG Sbjct: 446 EELGLRAPQWVRDKMVTMCMRCQEPFNALTRRRHHCRACG 485 >sp|Q8BY35|FGD2_MOUSE FYVE, RhoGEF and PH domain-containing protein 2 OS=Mus musculus GN=Fgd2 PE=2 SV=1 Length = 655 Score = 52 bits (124), Expect = 5e-007 Identities = 21/40 (52%), Positives = 25/40 (62%) Frame = -1 Query: 121 EILEAEPPEWLPDSSSIVCMQCTSPFTALTRGRHHCRFCG 2 E L P+W+ D +CM+C PF ALTR RHHCR CG Sbjct: 446 EELGLRAPQWVRDKMVTMCMRCQEPFNALTRRRHHCRACG 485 >sp|Q91ZT5|FGD4_MOUSE FYVE, RhoGEF and PH domain-containing protein 4 OS=Mus musculus GN=Fgd4 PE=2 SV=1 Length = 766 Score = 49 bits (115), Expect = 5e-006 Identities = 18/33 (54%), Positives = 22/33 (66%) Frame = -1 Query: 100 PEWLPDSSSIVCMQCTSPFTALTRGRHHCRFCG 2 P W+ D+ +CM+C F ALTR RHHCR CG Sbjct: 554 PRWIRDNEVTMCMKCKESFNALTRRRHHCRACG 586 >sp|O88387|FGD4_RAT FYVE, RhoGEF and PH domain-containing protein 4 OS=Rattus norvegicus GN=Fgd4 PE=1 SV=1 Length = 766 Score = 49 bits (115), Expect = 5e-006 Identities = 18/33 (54%), Positives = 22/33 (66%) Frame = -1 Query: 100 PEWLPDSSSIVCMQCTSPFTALTRGRHHCRFCG 2 P W+ D+ +CM+C F ALTR RHHCR CG Sbjct: 554 PRWIRDNEVTMCMKCKESFNALTRRRHHCRACG 586 >sp|Q9HCC9|ZFY28_HUMAN Zinc finger FYVE domain-containing protein 28 OS=Homo sapiens GN=ZFYVE28 PE=2 SV=2 Length = 887 Score = 49 bits (114), Expect = 7e-006 Identities = 18/35 (51%), Positives = 24/35 (68%), Gaps = 1/35 (2%) Frame = -1 Query: 106 EPPEWLPDSSSIVCMQCTSPFTALTRGRHHCRFCG 2 +PPEW+PD + C C +PFT + R +HHCR CG Sbjct: 810 DPPEWVPDEACGFCTACKAPFTVIRR-KHHCRSCG 843 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,192,140,658 Number of Sequences: 462764 Number of Extensions: 15192140658 Number of Successful Extensions: 146257600 Number of sequences better than 0.0: 0 |