BLASTX 7.6.2 Query= RU10134 /QuerySize=294 (293 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|P0AEC7|BARA_ECO57 Signal transduction histidine-protein kinas... 49 6e-006 sp|P0AEC6|BARA_ECOL6 Signal transduction histidine-protein kinas... 49 6e-006 sp|P0AEC5|BARA_ECOLI Signal transduction histidine-protein kinas... 49 6e-006 sp|P59342|BARA_SHIFL Signal transduction histidine-protein kinas... 49 6e-006 >sp|P0AEC7|BARA_ECO57 Signal transduction histidine-protein kinase barA OS=Escherichia coli O157:H7 GN=barA PE=3 SV=1 Length = 918 Score = 49 bits (115), Expect = 6e-006 Identities = 26/60 (43%), Positives = 38/60 (63%), Gaps = 2/60 (3%) Frame = -1 Query: 293 GDPGRFRQIITNLMGNSIKFTEKGHIFVTVHLVEELIDSIDVETESSSKNTLSGFPVADK 114 GDP R +QIITNL+GN+IKFTE G+I + V + + + V+ E ++T G P D+ Sbjct: 404 GDPLRLQQIITNLVGNAIKFTENGNIDILVE--KRALSNTKVQIEVQIRDTGIGIPERDQ 461 >sp|P0AEC6|BARA_ECOL6 Signal transduction histidine-protein kinase barA OS=Escherichia coli O6 GN=barA PE=3 SV=1 Length = 918 Score = 49 bits (115), Expect = 6e-006 Identities = 26/60 (43%), Positives = 38/60 (63%), Gaps = 2/60 (3%) Frame = -1 Query: 293 GDPGRFRQIITNLMGNSIKFTEKGHIFVTVHLVEELIDSIDVETESSSKNTLSGFPVADK 114 GDP R +QIITNL+GN+IKFTE G+I + V + + + V+ E ++T G P D+ Sbjct: 404 GDPLRLQQIITNLVGNAIKFTENGNIDILVE--KRALSNTKVQIEVQIRDTGIGIPERDQ 461 >sp|P0AEC5|BARA_ECOLI Signal transduction histidine-protein kinase barA OS=Escherichia coli (strain K12) GN=barA PE=1 SV=1 Length = 918 Score = 49 bits (115), Expect = 6e-006 Identities = 26/60 (43%), Positives = 38/60 (63%), Gaps = 2/60 (3%) Frame = -1 Query: 293 GDPGRFRQIITNLMGNSIKFTEKGHIFVTVHLVEELIDSIDVETESSSKNTLSGFPVADK 114 GDP R +QIITNL+GN+IKFTE G+I + V + + + V+ E ++T G P D+ Sbjct: 404 GDPLRLQQIITNLVGNAIKFTENGNIDILVE--KRALSNTKVQIEVQIRDTGIGIPERDQ 461 >sp|P59342|BARA_SHIFL Signal transduction histidine-protein kinase barA OS=Shigella flexneri GN=barA PE=3 SV=1 Length = 918 Score = 49 bits (115), Expect = 6e-006 Identities = 26/60 (43%), Positives = 38/60 (63%), Gaps = 2/60 (3%) Frame = -1 Query: 293 GDPGRFRQIITNLMGNSIKFTEKGHIFVTVHLVEELIDSIDVETESSSKNTLSGFPVADK 114 GDP R +QIITNL+GN+IKFTE G+I + V + + + V+ E ++T G P D+ Sbjct: 404 GDPLRLQQIITNLVGNAIKFTENGNIDILVE--KRALSNTKVQIEVQIRDTGIGIPERDQ 461 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,192,140,658 Number of Sequences: 462764 Number of Extensions: 15192140658 Number of Successful Extensions: 146257600 Number of sequences better than 0.0: 0 |