BLASTX 7.6.2 Query= RU10391 /QuerySize=379 (378 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9ZV88|BEH4_ARATH BES1/BZR1 homolog protein 4 OS=Arabidopsis ... 84 1e-016 >sp|Q9ZV88|BEH4_ARATH BES1/BZR1 homolog protein 4 OS=Arabidopsis thaliana GN=BEH4 PE=1 SV=1 Length = 325 Score = 84 bits (207), Expect = 1e-016 Identities = 41/61 (67%), Positives = 45/61 (73%), Gaps = 3/61 (4%) Frame = -3 Query: 208 EGSSLIPWLKHL--XXXXXXXXXXKLPN-IYIHGGSISAPVTPPLSSPTARTPRMNTDWD 38 +G SLIPWLKHL +LPN +YI GGSISAPVTPPLSSPTARTPRMNTDW Sbjct: 128 DGQSLIPWLKHLSTTSSSSASSSSRLPNYLYIPGGSISAPVTPPLSSPTARTPRMNTDWQ 187 Query: 37 E 35 + Sbjct: 188 Q 188 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,192,140,658 Number of Sequences: 462764 Number of Extensions: 15192140658 Number of Successful Extensions: 146257600 Number of sequences better than 0.0: 0 |