BLASTX 7.6.2 Query= RU10567 /QuerySize=340 (339 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|P43254|COP1_ARATH E3 ubiquitin-protein ligase COP1 OS=Arabido... 62 5e-010 sp|P93471|COP1_PEA E3 ubiquitin-protein ligase COP1 OS=Pisum sat... 59 5e-009 >sp|P43254|COP1_ARATH E3 ubiquitin-protein ligase COP1 OS=Arabidopsis thaliana GN=COP1 PE=1 SV=2 Length = 675 Score = 62 bits (150), Expect = 5e-010 Identities = 30/30 (100%) Frame = +3 Query: 3 FISAVCWKSDSPTMLTANSQGTIKVLVLAA 92 FISAVCWKSDSPTMLTANSQGTIKVLVLAA Sbjct: 646 FISAVCWKSDSPTMLTANSQGTIKVLVLAA 675 >sp|P93471|COP1_PEA E3 ubiquitin-protein ligase COP1 OS=Pisum sativum GN=COP1 PE=2 SV=1 Length = 672 Score = 59 bits (141), Expect = 5e-009 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 3 FISAVCWKSDSPTMLTANSQGTIKVLVLAA 92 FISAVCWKSD PT+LTANSQGTIKVLVLAA Sbjct: 643 FISAVCWKSDRPTILTANSQGTIKVLVLAA 672 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,192,140,658 Number of Sequences: 462764 Number of Extensions: 15192140658 Number of Successful Extensions: 146257600 Number of sequences better than 0.0: 0 |