BLASTX 7.6.2 Query= RU10599 /QuerySize=341 (340 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9C810|Y1342_ARATH PHD finger protein At1g33420 OS=Arabidopsi... 60 3e-009 sp|Q7SXB5|PF23B_DANRE PHD finger protein 23B OS=Danio rerio GN=p... 51 1e-006 >sp|Q9C810|Y1342_ARATH PHD finger protein At1g33420 OS=Arabidopsis thaliana GN=At1g33420 PE=1 SV=1 Length = 697 Score = 60 bits (143), Expect = 3e-009 Identities = 25/51 (49%), Positives = 30/51 (58%), Gaps = 3/51 (5%) Frame = +1 Query: 121 ESWTVDCLCGVTFDDGEEMVNCDECGVWVHTRCSRYVKGD---DNFVCDKC 264 ++W VDC CG DDGE M+ CD CGVW HTRC D F+C +C Sbjct: 600 DNWKVDCKCGTKDDDGERMLACDGCGVWHHTRCIGINNADALPSKFLCFRC 650 >sp|Q7SXB5|PF23B_DANRE PHD finger protein 23B OS=Danio rerio GN=phf23b PE=2 SV=1 Length = 315 Score = 51 bits (120), Expect = 1e-006 Identities = 26/65 (40%), Positives = 36/65 (55%), Gaps = 6/65 (9%) Frame = +1 Query: 118 DESW-TVDCLCGVTFDDGEEMVNCDECGVWVHTRCSRYVKGD--DNFVCDKCKSRNSRND 288 D+SW + C CG F G M+ C +C VWVH C++ K + D F C KC R+SR Sbjct: 253 DDSWDLITCYCGKPF-AGRPMIECSQCNVWVHLSCAKIKKSNVPDIFNCHKC--RDSRRS 309 Query: 289 SEETE 303 S + + Sbjct: 310 SHKKD 314 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,192,140,658 Number of Sequences: 462764 Number of Extensions: 15192140658 Number of Successful Extensions: 146257600 Number of sequences better than 0.0: 0 |