BLASTX 7.6.2 Query= RU10766 /QuerySize=267 (266 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9ASX5|Y5520_ARATH Uncharacterized aarF domain-containing pro... 55 1e-007 >sp|Q9ASX5|Y5520_ARATH Uncharacterized aarF domain-containing protein kinase At5g05200, chloroplastic OS=Arabidopsis thaliana GN=At5g05200 PE=1 SV=1 Length = 540 Score = 55 bits (130), Expect = 1e-007 Identities = 29/48 (60%), Positives = 36/48 (75%), Gaps = 8/48 (16%) Frame = +3 Query: 123 KGFTLLARYSQTQDLFSSRLQAWKFLLLSDSMENLPKLVEDIVRTSLS 266 KGF L A+YSQTQDLF+SRLQ+ +E LPKLVEDIV+TS++ Sbjct: 39 KGFVLTAQYSQTQDLFTSRLQS--------QIEKLPKLVEDIVQTSIN 78 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,192,140,658 Number of Sequences: 462764 Number of Extensions: 15192140658 Number of Successful Extensions: 146257600 Number of sequences better than 0.0: 0 |