BLASTX 7.6.2 Query= RU13281 /QuerySize=258 (257 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9ZWA6|MGP_ARATH Zinc finger protein MAGPIE OS=Arabidopsis th... 49 5e-006 >sp|Q9ZWA6|MGP_ARATH Zinc finger protein MAGPIE OS=Arabidopsis thaliana GN=MGP PE=1 SV=1 Length = 506 Score = 49 bits (116), Expect = 5e-006 Identities = 21/55 (38%), Positives = 32/55 (58%) Frame = +3 Query: 39 PPGTYEILQLEKEEILAPHTHFCAICGKGFKRDANLRMHMRGHGDEYKTPAALAK 203 P E++ L + ++A + C ICGKGF+RD NL++H RGH +K +K Sbjct: 50 PDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLKQRTSK 104 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,147,680,677 Number of Sequences: 462764 Number of Extensions: 17147680677 Number of Successful Extensions: 155595402 Number of sequences better than 0.0: 0 |