BLASTX 7.6.2 Query= RU13384 /QuerySize=194 (193 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|P49249|IN22_MAIZE IN2-2 protein OS=Zea mays GN=IN2-2 PE=2 SV=1 89 4e-018 sp|P40691|A115_TOBAC Auxin-induced protein PCNT115 OS=Nicotiana ... 88 1e-017 >sp|P49249|IN22_MAIZE IN2-2 protein OS=Zea mays GN=IN2-2 PE=2 SV=1 Length = 306 Score = 89 bits (220), Expect = 4e-018 Identities = 40/50 (80%), Positives = 47/50 (94%) Frame = +3 Query: 42 MAGMRRMKLGSQGLEVSAQGLGCMGMSAFYGPPKPEADMIKLIHHAVESG 191 + + R+KLGSQGLEVSAQGLGCMGMSAFYGPPKPE++MIKLIHHAV++G Sbjct: 5 LVSVPRIKLGSQGLEVSAQGLGCMGMSAFYGPPKPESEMIKLIHHAVDAG 54 >sp|P40691|A115_TOBAC Auxin-induced protein PCNT115 OS=Nicotiana tabacum PE=2 SV=1 Length = 307 Score = 88 bits (217), Expect = 1e-017 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = +3 Query: 57 RMKLGSQGLEVSAQGLGCMGMSAFYGPPKPEADMIKLIHHAVESG 191 R+KLGSQGLEVSAQGLGCMGMSAFYGPPKPE DMI+LIHHA+ SG Sbjct: 10 RIKLGSQGLEVSAQGLGCMGMSAFYGPPKPEPDMIQLIHHAINSG 54 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,147,680,677 Number of Sequences: 462764 Number of Extensions: 17147680677 Number of Successful Extensions: 155595402 Number of sequences better than 0.0: 0 |