BLASTX 7.6.2 Query= RU13665 /QuerySize=263 (262 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9LPI7|NAC12_ARATH NAC domain-containing protein 12 OS=Arabid... 52 7e-007 sp|O49255|NAC29_ARATH NAC domain-containing protein 29 OS=Arabid... 52 7e-007 sp|Q84WP6|NAC43_ARATH NAC domain-containing protein 43 OS=Arabid... 52 9e-007 >sp|Q9LPI7|NAC12_ARATH NAC domain-containing protein 12 OS=Arabidopsis thaliana GN=NST3 PE=2 SV=1 Length = 358 Score = 52 bits (123), Expect = 7e-007 Identities = 22/50 (44%), Positives = 34/50 (68%) Frame = +1 Query: 112 MDMGVVSLSSLPLGFRFRPTDEELIDFYLRSKINGNHKQVSVIREIDVCK 261 +++ + S +P GFRF PT+EEL+ +YLR K+N + VIRE+D+ K Sbjct: 6 VNLSINGQSKVPPGFRFHPTEEELLHYYLRKKVNSQKIDLDVIREVDLNK 55 >sp|O49255|NAC29_ARATH NAC domain-containing protein 29 OS=Arabidopsis thaliana GN=NAP PE=2 SV=1 Length = 268 Score = 52 bits (123), Expect = 7e-007 Identities = 26/48 (54%), Positives = 33/48 (68%) Frame = +1 Query: 118 MGVVSLSSLPLGFRFRPTDEELIDFYLRSKINGNHKQVSVIREIDVCK 261 M V S S+LP GFRF PTDEELI +YLR++ VS+I E+D+ K Sbjct: 1 MEVTSQSTLPPGFRFHPTDEELIVYYLRNQTMSKPCPVSIIPEVDIYK 48 >sp|Q84WP6|NAC43_ARATH NAC domain-containing protein 43 OS=Arabidopsis thaliana GN=EMB2301 PE=2 SV=2 Length = 365 Score = 52 bits (122), Expect = 9e-007 Identities = 23/50 (46%), Positives = 33/50 (66%) Frame = +1 Query: 112 MDMGVVSLSSLPLGFRFRPTDEELIDFYLRSKINGNHKQVSVIREIDVCK 261 M + V S +P GFRF PT+EEL+ +YLR K+N + VIR++D+ K Sbjct: 6 MSISVNGQSQVPPGFRFHPTEEELLQYYLRKKVNSIEIDLDVIRDVDLNK 55 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,147,680,677 Number of Sequences: 462764 Number of Extensions: 17147680677 Number of Successful Extensions: 155595402 Number of sequences better than 0.0: 0 |