BLASTX 7.6.2 Query= RU14278 /QuerySize=242 (241 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9FG71|U172_ARATH UPF0172 protein At5g55940 OS=Arabidopsis th... 71 1e-012 >sp|Q9FG71|U172_ARATH UPF0172 protein At5g55940 OS=Arabidopsis thaliana GN=EMB2731 PE=2 SV=1 Length = 208 Score = 71 bits (173), Expect = 1e-012 Identities = 31/39 (79%), Positives = 39/39 (100%) Frame = +2 Query: 104 GELRYEIAQNAYIKLVLHALKHKTSAVNGILVGRVSPKN 220 GEL+YEI+QNAYIKLVLH+L+HKT+AVNG+LVGR+SPK+ Sbjct: 7 GELKYEISQNAYIKLVLHSLRHKTAAVNGVLVGRISPKD 45 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,147,680,677 Number of Sequences: 462764 Number of Extensions: 17147680677 Number of Successful Extensions: 155595402 Number of sequences better than 0.0: 0 |