BLASTX 7.6.2 Query= RU16312 /QuerySize=471 (470 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q8S1Z1|UTP11_ORYSJ Probable U3 small nucleolar RNA-associated... 140 5e-033 sp|Q9M223|UTP11_ARATH Probable U3 small nucleolar RNA-associated... 131 3e-030 sp|Q55C50|UTP11_DICDI Probable U3 small nucleolar RNA-associated... 93 7e-019 sp|P34247|UTP11_YEAST U3 small nucleolar RNA-associated protein ... 86 8e-017 sp|Q9CZJ1|UTP11_MOUSE Probable U3 small nucleolar RNA-associated... 83 5e-016 sp|Q10106|UTP11_SCHPO Probable U3 small nucleolar RNA-associated... 83 7e-016 sp|Q9Y3A2|UTP11_HUMAN Probable U3 small nucleolar RNA-associated... 80 3e-015 sp|Q8R5K5|UTP11_RAT Probable U3 small nucleolar RNA-associated p... 79 1e-014 sp|Q9W3C0|UTP11_DROME Probable U3 small nucleolar RNA-associated... 78 2e-014 sp|Q09462|UTP11_CAEEL Probable U3 small nucleolar RNA-associated... 75 1e-013 sp|Q9U178|UTP11_LEIMA Probable U3 small nucleolar RNA-associated... 63 6e-010 sp|Q8I4V5|UTP11_PLAF7 Probable U3 small nucleolar RNA-associated... 63 7e-010 >sp|Q8S1Z1|UTP11_ORYSJ Probable U3 small nucleolar RNA-associated protein 11 OS=Oryza sativa subsp. japonica GN=Os01g0810000 PE=2 SV=2 Length = 229 Score = 140 bits (351), Expect = 5e-033 Identities = 63/85 (74%), Positives = 77/85 (90%) Frame = +3 Query: 216 MSSLRNAVSRRAHKERSQPESRKKFGFLEKHKDYVQRAKVYHKKEETLQILKQKARFRNP 395 MSSLRNA+ RRAHKER+QPESRKKFG LEKHKDY+ RAK +H+KEET++ LK+KA FRNP Sbjct: 1 MSSLRNAIQRRAHKERAQPESRKKFGLLEKHKDYIVRAKAFHQKEETIRKLKEKASFRNP 60 Query: 396 DEFYFKMINTRTVDGVHKIEGQANK 470 DEFYFKMIN++TVDG+H+ + +ANK Sbjct: 61 DEFYFKMINSKTVDGIHRPKPEANK 85 >sp|Q9M223|UTP11_ARATH Probable U3 small nucleolar RNA-associated protein 11 OS=Arabidopsis thaliana GN=At3g60360 PE=2 SV=1 Length = 228 Score = 131 bits (327), Expect = 3e-030 Identities = 60/85 (70%), Positives = 73/85 (85%) Frame = +3 Query: 216 MSSLRNAVSRRAHKERSQPESRKKFGFLEKHKDYVQRAKVYHKKEETLQILKQKARFRNP 395 MSSLRNA+ R AHKERSQPE+RK+FG LEKHKDY+ RA YHKK+ETL+IL+QKA F+NP Sbjct: 1 MSSLRNAIPRPAHKERSQPEARKRFGILEKHKDYIIRANAYHKKQETLKILRQKAAFKNP 60 Query: 396 DEFYFKMINTRTVDGVHKIEGQANK 470 DEF FKMIN++TVDG H+ + + NK Sbjct: 61 DEFNFKMINSKTVDGRHRPKDEVNK 85 >sp|Q55C50|UTP11_DICDI Probable U3 small nucleolar RNA-associated protein 11 OS=Dictyostelium discoideum GN=utp11 PE=3 SV=1 Length = 250 Score = 93 bits (229), Expect = 7e-019 Identities = 44/75 (58%), Positives = 59/75 (78%) Frame = +3 Query: 222 SLRNAVSRRAHKERSQPESRKKFGFLEKHKDYVQRAKVYHKKEETLQILKQKARFRNPDE 401 +LR + +RA +ER QPES KK GFLE+ KDYV+RAK Y+ K +TL+ LK +A F+NPDE Sbjct: 5 NLRRLLPQRAKQERPQPESSKKKGFLERKKDYVERAKDYNNKRDTLKKLKLQAAFKNPDE 64 Query: 402 FYFKMINTRTVDGVH 446 F +KMI+++ VDGVH Sbjct: 65 FNYKMISSKLVDGVH 79 >sp|P34247|UTP11_YEAST U3 small nucleolar RNA-associated protein 11 OS=Saccharomyces cerevisiae GN=UTP11 PE=1 SV=1 Length = 256 Score = 86 bits (211), Expect = 8e-017 Identities = 37/72 (51%), Positives = 57/72 (79%) Frame = +3 Query: 216 MSSLRNAVSRRAHKERSQPESRKKFGFLEKHKDYVQRAKVYHKKEETLQILKQKARFRNP 395 M+ L + V ++ H+ERSQ SR ++GFLEKHKDYV+RA+ +H+K+ TL++L++KA+ RNP Sbjct: 1 MAKLVHDVQKKQHRERSQLTSRSRYGFLEKHKDYVKRAQDFHRKQSTLKVLREKAKERNP 60 Query: 396 DEFYFKMINTRT 431 DE+Y M + +T Sbjct: 61 DEYYHAMHSRKT 72 >sp|Q9CZJ1|UTP11_MOUSE Probable U3 small nucleolar RNA-associated protein 11 OS=Mus musculus GN=Utp11l PE=2 SV=1 Length = 253 Score = 83 bits (204), Expect = 5e-016 Identities = 38/68 (55%), Positives = 49/68 (72%) Frame = +3 Query: 243 RRAHKERSQPESRKKFGFLEKHKDYVQRAKVYHKKEETLQILKQKARFRNPDEFYFKMIN 422 +R H+ERSQP RK+ G LEK KDY RA YHKK++ L+ L++KA +NPDEFY+KM Sbjct: 13 QREHRERSQPGFRKRLGLLEKKKDYKLRANDYHKKQDFLRALRKKALEKNPDEFYYKMTR 72 Query: 423 TRTVDGVH 446 + DGVH Sbjct: 73 AKLQDGVH 80 >sp|Q10106|UTP11_SCHPO Probable U3 small nucleolar RNA-associated protein 11 OS=Schizosaccharomyces pombe GN=SPAC18G6.06 PE=2 SV=1 Length = 249 Score = 83 bits (203), Expect = 7e-016 Identities = 39/75 (52%), Positives = 55/75 (73%) Frame = +3 Query: 219 SSLRNAVSRRAHKERSQPESRKKFGFLEKHKDYVQRAKVYHKKEETLQILKQKARFRNPD 398 SS +NA R+ H+ER+QP R+K+G LEK KDY QRA+ Y K++ L+ L++KA RNPD Sbjct: 3 SSFKNAGQRKNHRERAQPFERRKWGLLEKRKDYAQRAQDYKTKQKKLKRLREKALERNPD 62 Query: 399 EFYFKMINTRTVDGV 443 EFY +M + +T +GV Sbjct: 63 EFYHEMTHKKTKNGV 77 >sp|Q9Y3A2|UTP11_HUMAN Probable U3 small nucleolar RNA-associated protein 11 OS=Homo sapiens GN=UTP11L PE=1 SV=2 Length = 253 Score = 80 bits (197), Expect = 3e-015 Identities = 39/71 (54%), Positives = 49/71 (69%) Frame = +3 Query: 243 RRAHKERSQPESRKKFGFLEKHKDYVQRAKVYHKKEETLQILKQKARFRNPDEFYFKMIN 422 +R H+ERSQP RK G LEK KDY RA Y KK+E L+ L++KA +NPDEFY+KM Sbjct: 13 QREHRERSQPGFRKHLGLLEKKKDYKLRADDYRKKQEYLKALRKKALEKNPDEFYYKMTR 72 Query: 423 TRTVDGVHKIE 455 + DGVH I+ Sbjct: 73 VKLQDGVHIIK 83 >sp|Q8R5K5|UTP11_RAT Probable U3 small nucleolar RNA-associated protein 11 OS=Rattus norvegicus GN=Utp11l PE=2 SV=1 Length = 253 Score = 79 bits (193), Expect = 1e-014 Identities = 41/81 (50%), Positives = 54/81 (66%), Gaps = 2/81 (2%) Frame = +3 Query: 219 SSLRNAVS--RRAHKERSQPESRKKFGFLEKHKDYVQRAKVYHKKEETLQILKQKARFRN 392 ++ R AV +R ++ERSQP RK G LEK KDY RA Y KK+E L+ L++KA +N Sbjct: 3 AAFRKAVKSRQREYRERSQPGFRKHLGLLEKKKDYKLRADDYRKKQEYLKALRKKALEKN 62 Query: 393 PDEFYFKMINTRTVDGVHKIE 455 PDEFY+KM + DGVH I+ Sbjct: 63 PDEFYYKMTRVKLQDGVHIIK 83 >sp|Q9W3C0|UTP11_DROME Probable U3 small nucleolar RNA-associated protein 11 OS=Drosophila melanogaster GN=CG1789 PE=2 SV=1 Length = 237 Score = 78 bits (190), Expect = 2e-014 Identities = 39/79 (49%), Positives = 57/79 (72%), Gaps = 2/79 (2%) Frame = +3 Query: 216 MSSLRNA--VSRRAHKERSQPESRKKFGFLEKHKDYVQRAKVYHKKEETLQILKQKARFR 389 MSS +NA +++ H+ER QPESR+ GFLEK KDY +RA KK++TL++L ++A+ + Sbjct: 1 MSSWKNASKSNQKVHRERHQPESRQHLGFLEKKKDYKKRAIDAQKKQKTLKLLYRRAQNK 60 Query: 390 NPDEFYFKMINTRTVDGVH 446 NPDEFY MIN++ + H Sbjct: 61 NPDEFYHHMINSKLSNDEH 79 >sp|Q09462|UTP11_CAEEL Probable U3 small nucleolar RNA-associated protein 11 OS=Caenorhabditis elegans GN=C16C10.2 PE=2 SV=1 Length = 262 Score = 75 bits (183), Expect = 1e-013 Identities = 38/82 (46%), Positives = 58/82 (70%), Gaps = 2/82 (2%) Frame = +3 Query: 207 LSNMSSLRNAVS-RRAHKERSQPESRKKFGFLEKHKDYVQRAKVYHKKEETLQILKQKAR 383 +S++ S+ +S +R H+ERSQPE+R+K+G LEK KDY RA+ Y KK +T++ LK+ A Sbjct: 1 MSSLVSISKKLSGQRQHRERSQPEARRKYGELEKKKDYKLRAEDYQKKRDTIKKLKKSAM 60 Query: 384 FRNPDEFYFKMINTRT-VDGVH 446 +N DE++ M+N+ T DG H Sbjct: 61 DKNQDEYHHHMVNSETWADGRH 82 >sp|Q9U178|UTP11_LEIMA Probable U3 small nucleolar RNA-associated protein 11 OS=Leishmania major GN=LmjF19.0670 PE=3 SV=1 Length = 361 Score = 63 bits (152), Expect = 6e-010 Identities = 34/66 (51%), Positives = 41/66 (62%) Frame = +3 Query: 219 SSLRNAVSRRAHKERSQPESRKKFGFLEKHKDYVQRAKVYHKKEETLQILKQKARFRNPD 398 S L + R+ H ERSQP+SR+ G LEKHKD+V RAK K LQ +K+ A RNPD Sbjct: 12 SGLDKHLKRKTHLERSQPKSRQHLGQLEKHKDHVLRAKKRKVKVRRLQEIKRAAAQRNPD 71 Query: 399 EFYFKM 416 EF M Sbjct: 72 EFNIGM 77 >sp|Q8I4V5|UTP11_PLAF7 Probable U3 small nucleolar RNA-associated protein 11 OS=Plasmodium falciparum (isolate 3D7) GN=PFL2295w PE=3 SV=1 Length = 212 Score = 63 bits (151), Expect = 7e-010 Identities = 28/74 (37%), Positives = 47/74 (63%) Frame = +3 Query: 216 MSSLRNAVSRRAHKERSQPESRKKFGFLEKHKDYVQRAKVYHKKEETLQILKQKARFRNP 395 MS+ +N + +R + ER Q + R G LEK DY +R ++Y KK++ +LK+K +NP Sbjct: 1 MSNFKNIIPKRTYLERGQAKHRLHLGELEKKVDYGKRREIYKKKKKIENVLKEKIMTKNP 60 Query: 396 DEFYFKMINTRTVD 437 DEF+ M+++R + Sbjct: 61 DEFHTGMVHSRVTE 74 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,192,346,547 Number of Sequences: 462764 Number of Extensions: 18192346547 Number of Successful Extensions: 175456667 Number of sequences better than 0.0: 0 |