BLASTX 7.6.2 Query= RU18131 /QuerySize=162 (161 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q8VWG3|TT1_ARATH Protein TRANSPARENT TESTA 1 OS=Arabidopsis t... 100 3e-021 >sp|Q8VWG3|TT1_ARATH Protein TRANSPARENT TESTA 1 OS=Arabidopsis thaliana GN=TT1 PE=2 SV=1 Length = 303 Score = 100 bits (248), Expect = 3e-021 Identities = 40/50 (80%), Positives = 42/50 (84%) Frame = +2 Query: 5 CRKCGKAFAVRGDWRTHEKNCGKLWYCTCGSDFKHKRSLKDHIKAFGQSH 154 CR CGK AV+GDWRTHEKNCGK W C CGSDFKHKRSLKDH+KAFG H Sbjct: 231 CRLCGKLLAVKGDWRTHEKNCGKRWVCVCGSDFKHKRSLKDHVKAFGSGH 280 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,157,057,276 Number of Sequences: 462764 Number of Extensions: 20157057276 Number of Successful Extensions: 184850746 Number of sequences better than 0.0: 0 |