BLASTX 7.6.2 Query= RU19103 /QuerySize=322 (321 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9FGJ3|NFYB2_ARATH Nuclear transcription factor Y subunit B-2... 72 5e-013 sp|Q67XJ2|NFYBA_ARATH Nuclear transcription factor Y subunit B-1... 58 1e-008 sp|O23310|NFYB3_ARATH Nuclear transcription factor Y subunit B-3... 56 4e-008 sp|Q8VYK4|NFYB8_ARATH Nuclear transcription factor Y subunit B-8... 54 2e-007 sp|Q9SFD8|NFYB9_ARATH Nuclear transcription factor Y subunit B-9... 53 4e-007 sp|P25209|NFYB_MAIZE Nuclear transcription factor Y subunit B OS... 53 4e-007 sp|Q5QMG3|NFYB2_ORYSJ Nuclear transcription factor Y subunit B-2... 52 5e-007 sp|Q60EQ4|NFYB3_ORYSJ Nuclear transcription factor Y subunit B-3... 52 5e-007 sp|O82248|NFYB5_ARATH Nuclear transcription factor Y subunit B-5... 51 1e-006 sp|Q9SLG0|NFYB1_ARATH Nuclear transcription factor Y subunit B-1... 49 6e-006 >sp|Q9FGJ3|NFYB2_ARATH Nuclear transcription factor Y subunit B-2 OS=Arabidopsis thaliana GN=NFYB2 PE=2 SV=1 Length = 190 Score = 72 bits (176), Expect = 5e-013 Identities = 38/53 (71%), Positives = 40/53 (75%), Gaps = 2/53 (3%) Frame = -1 Query: 159 DSDNDSGGGHNSPGGYTKSEPPVLPREQDRLLPIANVSRIMKKALPANAKISK 1 DSD DSGGG N G + + PREQDR LPIANVSRIMKKALPANAKISK Sbjct: 3 DSDRDSGGGQN--GNNQNGQSSLSPREQDRFLPIANVSRIMKKALPANAKISK 53 >sp|Q67XJ2|NFYBA_ARATH Nuclear transcription factor Y subunit B-10 OS=Arabidopsis thaliana GN=NFYB10 PE=2 SV=1 Length = 176 Score = 58 bits (138), Expect = 1e-008 Identities = 29/55 (52%), Positives = 36/55 (65%) Frame = -1 Query: 165 MADSDNDSGGGHNSPGGYTKSEPPVLPREQDRLLPIANVSRIMKKALPANAKISK 1 MA+S GGG + G +S + REQDR LPIAN+SRIMK+ LP N KI+K Sbjct: 1 MAESQTGGGGGGSHESGGDQSPRSLNVREQDRFLPIANISRIMKRGLPLNGKIAK 55 >sp|O23310|NFYB3_ARATH Nuclear transcription factor Y subunit B-3 OS=Arabidopsis thaliana GN=NFYB3 PE=2 SV=1 Length = 161 Score = 56 bits (134), Expect = 4e-008 Identities = 31/46 (67%), Positives = 32/46 (69%), Gaps = 7/46 (15%) Frame = -1 Query: 138 GGHNSPGGYTKSEPPVLPREQDRLLPIANVSRIMKKALPANAKISK 1 GGH G + REQDR LPIANVSRIMKKALPANAKISK Sbjct: 9 GGHKDGGNAS-------TREQDRFLPIANVSRIMKKALPANAKISK 47 >sp|Q8VYK4|NFYB8_ARATH Nuclear transcription factor Y subunit B-8 OS=Arabidopsis thaliana GN=NFYB8 PE=2 SV=1 Length = 173 Score = 54 bits (128), Expect = 2e-007 Identities = 31/56 (55%), Positives = 37/56 (66%), Gaps = 1/56 (1%) Frame = -1 Query: 165 MADSDNDSGGGHNS-PGGYTKSEPPVLPREQDRLLPIANVSRIMKKALPANAKISK 1 MA+S S GG S G +S + REQDR LPIAN+SRIMK+ LPAN KI+K Sbjct: 1 MAESQAKSPGGCGSHESGGDQSPRSLHVREQDRFLPIANISRIMKRGLPANGKIAK 56 >sp|Q9SFD8|NFYB9_ARATH Nuclear transcription factor Y subunit B-9 OS=Arabidopsis thaliana GN=NFYB9 PE=1 SV=1 Length = 208 Score = 53 bits (125), Expect = 4e-007 Identities = 24/47 (51%), Positives = 34/47 (72%) Frame = -1 Query: 144 SGGGHNSPGGYTKSEPPVLPREQDRLLPIANVSRIMKKALPANAKIS 4 +G G + G + +PP + REQD+ +PIANV RIM+K LP++AKIS Sbjct: 8 AGAGDKNNGIVVQQQPPCVAREQDQYMPIANVIRIMRKTLPSHAKIS 54 >sp|P25209|NFYB_MAIZE Nuclear transcription factor Y subunit B OS=Zea mays GN=NFY2 PE=2 SV=1 Length = 179 Score = 53 bits (125), Expect = 4e-007 Identities = 28/54 (51%), Positives = 33/54 (61%) Frame = -1 Query: 162 ADSDNDSGGGHNSPGGYTKSEPPVLPREQDRLLPIANVSRIMKKALPANAKISK 1 A + GGG + G REQDR LPIAN+SRIMKKA+PAN KI+K Sbjct: 4 APASPGGGGGSHESGSPRGGGGGGSVREQDRFLPIANISRIMKKAIPANGKIAK 57 >sp|Q5QMG3|NFYB2_ORYSJ Nuclear transcription factor Y subunit B-2 OS=Oryza sativa subsp. japonica GN=NFYB2 PE=2 SV=1 Length = 178 Score = 52 bits (124), Expect = 5e-007 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 3/50 (6%) Frame = -1 Query: 141 GGGHNSPGGYTKSEPPVLP---REQDRLLPIANVSRIMKKALPANAKISK 1 GG + G+ +S P REQDR LPIAN+SRIMKKA+PAN KI+K Sbjct: 11 GGAGMADAGHDESGSPPRSGGVREQDRFLPIANISRIMKKAVPANGKIAK 60 >sp|Q60EQ4|NFYB3_ORYSJ Nuclear transcription factor Y subunit B-3 OS=Oryza sativa subsp. japonica GN=NFYB3 PE=1 SV=2 Length = 185 Score = 52 bits (124), Expect = 5e-007 Identities = 29/53 (54%), Positives = 34/53 (64%), Gaps = 4/53 (7%) Frame = -1 Query: 159 DSDNDSGGGHNSPGGYTKSEPPVLPREQDRLLPIANVSRIMKKALPANAKISK 1 +S + GGG GG REQDR LPIAN+SRIMKKA+PAN KI+K Sbjct: 16 ESGSPRGGGGGGGGGGGGGG----VREQDRFLPIANISRIMKKAIPANGKIAK 64 >sp|O82248|NFYB5_ARATH Nuclear transcription factor Y subunit B-5 OS=Arabidopsis thaliana GN=NFYB5 PE=2 SV=1 Length = 160 Score = 51 bits (121), Expect = 1e-006 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = -1 Query: 108 KSEPPVLPREQDRLLPIANVSRIMKKALPANAKISK 1 + E ++ +EQDRLLPIANV RIMK LPANAK+SK Sbjct: 42 QQEESMMVKEQDRLLPIANVGRIMKNILPANAKVSK 77 >sp|Q9SLG0|NFYB1_ARATH Nuclear transcription factor Y subunit B-1 OS=Arabidopsis thaliana GN=NFYB1 PE=2 SV=2 Length = 141 Score = 49 bits (115), Expect = 6e-006 Identities = 23/28 (82%), Positives = 24/28 (85%) Frame = -1 Query: 84 REQDRLLPIANVSRIMKKALPANAKISK 1 REQDR LPIAN+SRIMKKALP N KI K Sbjct: 20 REQDRYLPIANISRIMKKALPPNGKIGK 47 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,133,449,078 Number of Sequences: 462764 Number of Extensions: 22133449078 Number of Successful Extensions: 193841713 Number of sequences better than 0.0: 0 |