BLASTX 7.6.2 Query= RU19282 /QuerySize=210 (209 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q6TCH7|PAQR3_HUMAN Progestin and adipoQ receptor family membe... 54 3e-007 sp|Q6TCG8|PAQR3_MOUSE Progestin and adipoQ receptor family membe... 54 3e-007 sp|Q96A54|ADR1_HUMAN Adiponectin receptor protein 1 OS=Homo sapi... 50 4e-006 sp|Q91VH1|ADR1_MOUSE Adiponectin receptor protein 1 OS=Mus muscu... 50 4e-006 sp|Q09910|YAJB_SCHPO Uncharacterized protein C30D11.11 OS=Schizo... 49 8e-006 >sp|Q6TCH7|PAQR3_HUMAN Progestin and adipoQ receptor family member 3 OS=Homo sapiens GN=PAQR3 PE=1 SV=2 Length = 311 Score = 54 bits (127), Expect = 3e-007 Identities = 25/51 (49%), Positives = 33/51 (64%) Frame = +1 Query: 55 LVKFKDLPQYMKDNEYILDYYRCEWPLKDVIFSVFAWHNETLNIWTHLLGF 207 L ++ +P +KDN YI D YR P + I S+F NET+NIW+HLLGF Sbjct: 30 LYTYEQIPGSLKDNPYITDGYRAYLPSRLCIKSLFILSNETVNIWSHLLGF 80 >sp|Q6TCG8|PAQR3_MOUSE Progestin and adipoQ receptor family member 3 OS=Mus musculus GN=Paqr3 PE=2 SV=1 Length = 311 Score = 54 bits (127), Expect = 3e-007 Identities = 25/51 (49%), Positives = 33/51 (64%) Frame = +1 Query: 55 LVKFKDLPQYMKDNEYILDYYRCEWPLKDVIFSVFAWHNETLNIWTHLLGF 207 L ++ +P +KDN YI D YR P + I S+F NET+NIW+HLLGF Sbjct: 30 LYTYEQIPVSLKDNPYITDGYRAYLPSRLCIKSLFILSNETVNIWSHLLGF 80 >sp|Q96A54|ADR1_HUMAN Adiponectin receptor protein 1 OS=Homo sapiens GN=ADIPOR1 PE=1 SV=1 Length = 375 Score = 50 bits (117), Expect = 4e-006 Identities = 24/52 (46%), Positives = 33/52 (63%), Gaps = 1/52 (1%) Frame = +1 Query: 55 LVKFKDLPQYMKDNEYILDYYRCEWPLKDVIF-SVFAWHNETLNIWTHLLGF 207 ++ + LP ++KDN+Y+L +R P F S+F H ET NIWTHLLGF Sbjct: 94 VIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGF 145 >sp|Q91VH1|ADR1_MOUSE Adiponectin receptor protein 1 OS=Mus musculus GN=Adipor1 PE=1 SV=1 Length = 375 Score = 50 bits (117), Expect = 4e-006 Identities = 24/52 (46%), Positives = 33/52 (63%), Gaps = 1/52 (1%) Frame = +1 Query: 55 LVKFKDLPQYMKDNEYILDYYRCEWPLKDVIF-SVFAWHNETLNIWTHLLGF 207 ++ + LP ++KDN+Y+L +R P F S+F H ET NIWTHLLGF Sbjct: 94 VIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGF 145 >sp|Q09910|YAJB_SCHPO Uncharacterized protein C30D11.11 OS=Schizosaccharomyces pombe GN=SPAC30D11.11 PE=2 SV=1 Length = 442 Score = 49 bits (114), Expect = 8e-006 Identities = 21/51 (41%), Positives = 29/51 (56%) Frame = +1 Query: 55 LVKFKDLPQYMKDNEYILDYYRCEWPLKDVIFSVFAWHNETLNIWTHLLGF 207 L+ ++LP +N YI+ YR + S+ +WHNET NIWTHL F Sbjct: 168 LITLEELPVQWHNNPYIIRGYRFYTSKRKCFRSILSWHNETFNIWTHLSAF 218 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,133,449,078 Number of Sequences: 462764 Number of Extensions: 22133449078 Number of Successful Extensions: 193841713 Number of sequences better than 0.0: 0 |