BLASTX 7.6.2 Query= RU20461 /QuerySize=818 (817 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9LKL2|APRR1_ARATH Two-component response regulator-like APRR... 112 2e-024 sp|Q689G9|PRR1_ORYSJ Two-component response regulator-like PRR1 ... 87 8e-017 sp|Q93WK5|APRR7_ARATH Two-component response regulator-like APRR... 80 1e-014 sp|Q8L500|APRR9_ARATH Two-component response regulator-like APRR... 77 9e-014 sp|Q689G6|PRR95_ORYSJ Two-component response regulator-like PRR9... 74 1e-012 sp|Q6LA42|APRR5_ARATH Two-component response regulator-like APRR... 74 1e-012 sp|Q9LVG4|APRR3_ARATH Two-component response regulator-like APRR... 73 2e-012 sp|A2YQ93|PRR37_ORYSI Two-component response regulator-like PRR3... 71 6e-012 sp|Q0D3B6|PRR37_ORYSJ Two-component response regulator-like PRR3... 71 6e-012 sp|A2XFB7|PRR73_ORYSI Two-component response regulator-like PRR7... 68 5e-011 sp|Q10N34|PRR73_ORYSJ Two-component response regulator-like PRR7... 68 5e-011 sp|Q9M9B3|COL8_ARATH Zinc finger protein CONSTANS-LIKE 8 OS=Arab... 54 8e-007 sp|Q39057|CONS_ARATH Zinc finger protein CONSTANS OS=Arabidopsis... 54 1e-006 sp|Q9C9A9|COL7_ARATH Zinc finger protein CONSTANS-LIKE 7 OS=Arab... 53 2e-006 sp|Q8RWD0|COL16_ARATH Zinc finger protein CONSTANS-LIKE 16 OS=Ar... 52 3e-006 sp|Q8LG76|COL6_ARATH Zinc finger protein CONSTANS-LIKE 6 OS=Arab... 52 4e-006 >sp|Q9LKL2|APRR1_ARATH Two-component response regulator-like APRR1 OS=Arabidopsis thaliana GN=APRR1 PE=1 SV=1 Length = 618 Score = 112 bits (280), Expect = 2e-024 Identities = 52/65 (80%), Positives = 62/65 (95%) Frame = -1 Query: 817 VKLSKVDRREAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVRKVNGVDVDLN 638 V+++K+DRRE AL+KFR+KR +RCFDKKIRYVNRKRLAERRPRV+GQFVRK+NGV+VDLN Sbjct: 525 VRVNKLDRREEALLKFRRKRNQRCFDKKIRYVNRKRLAERRPRVKGQFVRKMNGVNVDLN 584 Query: 637 GQPAS 623 GQP S Sbjct: 585 GQPDS 589 >sp|Q689G9|PRR1_ORYSJ Two-component response regulator-like PRR1 OS=Oryza sativa subsp. japonica GN=PRR1 PE=2 SV=2 Length = 518 Score = 87 bits (215), Expect = 8e-017 Identities = 42/62 (67%), Positives = 48/62 (77%) Frame = -1 Query: 808 SKVDRREAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVRKVNGVDVDLNGQP 629 S+ +RR AAL KFR KRKERCFDKK+RYVNRK+LAE RPRVRGQFVR+ N D+ G Sbjct: 438 SRSERRAAALAKFRLKRKERCFDKKVRYVNRKKLAETRPRVRGQFVRQANYTDITSTGDD 497 Query: 628 AS 623 S Sbjct: 498 IS 499 >sp|Q93WK5|APRR7_ARATH Two-component response regulator-like APRR7 OS=Arabidopsis thaliana GN=APRR7 PE=2 SV=1 Length = 727 Score = 80 bits (197), Expect = 1e-014 Identities = 37/48 (77%), Positives = 44/48 (91%) Frame = -1 Query: 808 SKVDRREAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVRK 665 +K+ +REAAL KFRQKRKERCF KK+RY +RK+LAE+RPRVRGQFVRK Sbjct: 664 NKISQREAALTKFRQKRKERCFRKKVRYQSRKKLAEQRPRVRGQFVRK 711 >sp|Q8L500|APRR9_ARATH Two-component response regulator-like APRR9 OS=Arabidopsis thaliana GN=APRR9 PE=2 SV=2 Length = 468 Score = 77 bits (189), Expect = 9e-014 Identities = 35/46 (76%), Positives = 43/46 (93%) Frame = -1 Query: 796 RREAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVRKVN 659 +REAAL+KFR KRK+RCFDKK+RY +RK+LAE+RPRV+GQFVR VN Sbjct: 416 QREAALMKFRLKRKDRCFDKKVRYQSRKKLAEQRPRVKGQFVRTVN 461 >sp|Q689G6|PRR95_ORYSJ Two-component response regulator-like PRR95 OS=Oryza sativa subsp. japonica GN=PRR95 PE=2 SV=1 Length = 623 Score = 74 bits (180), Expect = 1e-012 Identities = 35/53 (66%), Positives = 45/53 (84%) Frame = -1 Query: 811 LSKVDRREAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVRKVNGV 653 L + +REAAL KFR KRK+RCF+KK+RY +RK LAE+RPRV+GQFVR+ +GV Sbjct: 568 LRHLSQREAALNKFRLKRKDRCFEKKVRYQSRKLLAEQRPRVKGQFVRQDHGV 620 >sp|Q6LA42|APRR5_ARATH Two-component response regulator-like APRR5 OS=Arabidopsis thaliana GN=APRR5 PE=1 SV=2 Length = 558 Score = 74 bits (179), Expect = 1e-012 Identities = 32/51 (62%), Positives = 45/51 (88%) Frame = -1 Query: 814 KLSKVDRREAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVRKV 662 K+ + +REAAL KFR KRK+RC++KK+RY +RK+LAE+RPR++GQFVR+V Sbjct: 502 KIQQSLQREAALTKFRMKRKDRCYEKKVRYESRKKLAEQRPRIKGQFVRQV 552 >sp|Q9LVG4|APRR3_ARATH Two-component response regulator-like APRR3 OS=Arabidopsis thaliana GN=APRR3 PE=1 SV=1 Length = 495 Score = 73 bits (177), Expect = 2e-012 Identities = 32/44 (72%), Positives = 41/44 (93%) Frame = -1 Query: 796 RREAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVRK 665 +REAAL+KFR KRKERCF+KK+RY +RK+LAE+RP V+GQF+RK Sbjct: 441 QREAALMKFRLKRKERCFEKKVRYHSRKKLAEQRPHVKGQFIRK 484 >sp|A2YQ93|PRR37_ORYSI Two-component response regulator-like PRR37 OS=Oryza sativa subsp. indica GN=PRR37 PE=2 SV=2 Length = 742 Score = 71 bits (173), Expect = 6e-012 Identities = 34/50 (68%), Positives = 43/50 (86%) Frame = -1 Query: 814 KLSKVDRREAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVRK 665 + ++ + R AA+IKFRQKRKER F KK+RY +RKRLAE+RPRVRGQFVR+ Sbjct: 675 RFTQREHRVAAVIKFRQKRKERNFGKKVRYQSRKRLAEQRPRVRGQFVRQ 724 >sp|Q0D3B6|PRR37_ORYSJ Two-component response regulator-like PRR37 OS=Oryza sativa subsp. japonica GN=PRR37 PE=2 SV=1 Length = 742 Score = 71 bits (173), Expect = 6e-012 Identities = 34/50 (68%), Positives = 43/50 (86%) Frame = -1 Query: 814 KLSKVDRREAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVRK 665 + ++ + R AA+IKFRQKRKER F KK+RY +RKRLAE+RPRVRGQFVR+ Sbjct: 675 RFTQREHRVAAVIKFRQKRKERNFGKKVRYQSRKRLAEQRPRVRGQFVRQ 724 >sp|A2XFB7|PRR73_ORYSI Two-component response regulator-like PRR73 OS=Oryza sativa subsp. indica GN=PRR73 PE=2 SV=2 Length = 767 Score = 68 bits (165), Expect = 5e-011 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = -1 Query: 793 REAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVRK 665 REAAL KFRQKRK R F KK+RY +RKRLAE+RPR+RGQFVR+ Sbjct: 712 REAALNKFRQKRKVRNFGKKVRYQSRKRLAEQRPRIRGQFVRQ 754 >sp|Q10N34|PRR73_ORYSJ Two-component response regulator-like PRR73 OS=Oryza sativa subsp. japonica GN=PRR73 PE=2 SV=1 Length = 767 Score = 68 bits (165), Expect = 5e-011 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = -1 Query: 793 REAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVRK 665 REAAL KFRQKRK R F KK+RY +RKRLAE+RPR+RGQFVR+ Sbjct: 712 REAALNKFRQKRKVRNFGKKVRYQSRKRLAEQRPRIRGQFVRQ 754 >sp|Q9M9B3|COL8_ARATH Zinc finger protein CONSTANS-LIKE 8 OS=Arabidopsis thaliana GN=COL8 PE=2 SV=1 Length = 313 Score = 54 bits (129), Expect = 8e-007 Identities = 25/48 (52%), Positives = 36/48 (75%) Frame = -1 Query: 793 REAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVRKVNGVD 650 REA + ++R KRK R F+KKIRY RK A++RPR++G+FVR+ +D Sbjct: 265 REARVWRYRDKRKNRLFEKKIRYEVRKVNADKRPRMKGRFVRRSLAID 312 >sp|Q39057|CONS_ARATH Zinc finger protein CONSTANS OS=Arabidopsis thaliana GN=CO PE=1 SV=1 Length = 373 Score = 54 bits (128), Expect = 1e-006 Identities = 26/50 (52%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = -1 Query: 814 KLSKVDRREAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVRK 665 +LS +D REA ++++R+KRK R F+K IRY +RK AE RPRV G+F ++ Sbjct: 300 QLSPMD-REARVLRYREKRKTRKFEKTIRYASRKAYAEIRPRVNGRFAKR 348 >sp|Q9C9A9|COL7_ARATH Zinc finger protein CONSTANS-LIKE 7 OS=Arabidopsis thaliana GN=COL7 PE=2 SV=1 Length = 392 Score = 53 bits (126), Expect = 2e-006 Identities = 22/45 (48%), Positives = 36/45 (80%) Frame = -1 Query: 793 REAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVRKVN 659 REA ++++++KR+ R F KKIRY RK AE+RPR++G+FV++ + Sbjct: 345 REARVLRYKEKRRTRLFSKKIRYEVRKLNAEQRPRIKGRFVKRTS 389 >sp|Q8RWD0|COL16_ARATH Zinc finger protein CONSTANS-LIKE 16 OS=Arabidopsis thaliana GN=COL16 PE=2 SV=2 Length = 417 Score = 52 bits (124), Expect = 3e-006 Identities = 23/45 (51%), Positives = 35/45 (77%) Frame = -1 Query: 793 REAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVRKVN 659 REA + ++R+KR+ R F KKIRY RK AE+RPR++G+FV++ + Sbjct: 361 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAS 405 >sp|Q8LG76|COL6_ARATH Zinc finger protein CONSTANS-LIKE 6 OS=Arabidopsis thaliana GN=COL6 PE=2 SV=2 Length = 406 Score = 52 bits (123), Expect = 4e-006 Identities = 23/43 (53%), Positives = 34/43 (79%) Frame = -1 Query: 793 REAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVRK 665 REA + ++R+KR+ R F KKIRY RK AE+RPR++G+FV++ Sbjct: 357 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR 399 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,133,449,078 Number of Sequences: 462764 Number of Extensions: 22133449078 Number of Successful Extensions: 193841713 Number of sequences better than 0.0: 0 |