BLASTX 7.6.2 Query= RU20620 /QuerySize=179 (178 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|P29675|SF3_HELAN Pollen-specific protein SF3 OS=Helianthus an... 77 2e-014 sp|Q4U4S6|XIRP2_MOUSE Xin actin-binding repeat-containing protei... 50 2e-006 >sp|P29675|SF3_HELAN Pollen-specific protein SF3 OS=Helianthus annuus GN=SF3 PE=2 SV=1 Length = 219 Score = 77 bits (188), Expect = 2e-014 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +3 Query: 51 MATFAGTTQKCKACEKTVYLVDQLTADNKVYHKACFRCHHC 173 M +F GTTQKC CEKTVYLVD+L A+ +VYHKACFRCHHC Sbjct: 1 MKSFTGTTQKCTVCEKTVYLVDKLVANQRVYHKACFRCHHC 41 >sp|Q4U4S6|XIRP2_MOUSE Xin actin-binding repeat-containing protein 2 OS=Mus musculus GN=Xirp2 PE=1 SV=1 Length = 3784 Score = 50 bits (119), Expect = 2e-006 Identities = 19/40 (47%), Positives = 27/40 (67%) Frame = +3 Query: 54 ATFAGTTQKCKACEKTVYLVDQLTADNKVYHKACFRCHHC 173 + F + C C+KTVY ++ L AD + +HK+CFRCHHC Sbjct: 3248 SAFLSDKEICIICQKTVYPMECLIADKQNFHKSCFRCHHC 3287 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,133,449,078 Number of Sequences: 462764 Number of Extensions: 22133449078 Number of Successful Extensions: 193841713 Number of sequences better than 0.0: 0 |