BLASTX 7.6.2 Query= RU21919 /QuerySize=601 (600 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q32L65|MARH2_BOVIN E3 ubiquitin-protein ligase MARCH2 OS=Bos ... 52 2e-006 >sp|Q32L65|MARH2_BOVIN E3 ubiquitin-protein ligase MARCH2 OS=Bos taurus GN=MARCH2 PE=2 SV=1 Length = 245 Score = 52 bits (124), Expect = 2e-006 Identities = 20/45 (44%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Frame = +2 Query: 179 RICHE-EESNNLESPCACSGTVKFAHRDCIQRWCNEKGNTTCEIC 310 RICHE +L SPC CSGT+ H+ C++RW + + CE+C Sbjct: 65 RICHEGANGESLLSPCGCSGTLGAVHKSCLERWLSSSNTSYCELC 109 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,194,098,521 Number of Sequences: 462764 Number of Extensions: 23194098521 Number of Successful Extensions: 213356894 Number of sequences better than 0.0: 0 |