BLASTX 7.6.2 Query= RU22346 /QuerySize=307 (306 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|P24068|OCS1_MAIZE Ocs element-binding factor 1 OS=Zea mays GN... 57 3e-008 sp|P12959|OP2_MAIZE Regulatory protein opaque-2 OS=Zea mays GN=O... 49 8e-006 >sp|P24068|OCS1_MAIZE Ocs element-binding factor 1 OS=Zea mays GN=OBF1 PE=2 SV=2 Length = 151 Score = 57 bits (135), Expect = 3e-008 Identities = 30/67 (44%), Positives = 41/67 (61%) Frame = +2 Query: 74 SARRSRMRKQEHLTDLTAQVGLLMKENNQILTSINVTNQLYLNLEAENCVLRAQMAELSN 253 SARRSR+RKQ+HL +L +V L +N ++ Y +E EN VLRA+ AEL + Sbjct: 37 SARRSRLRKQQHLDELVQEVARLQADNARVAARARDIASQYTRVEQENTVLRARAAELGD 96 Query: 254 RLQSPPE 274 RL+S E Sbjct: 97 RLRSVNE 103 >sp|P12959|OP2_MAIZE Regulatory protein opaque-2 OS=Zea mays GN=O2 PE=1 SV=1 Length = 453 Score = 49 bits (114), Expect = 8e-006 Identities = 28/63 (44%), Positives = 36/63 (57%) Frame = +2 Query: 74 SARRSRMRKQEHLTDLTAQVGLLMKENNQILTSINVTNQLYLNLEAENCVLRAQMAELSN 253 SARRSR RK HL +L QV L EN+ +L I NQ Y + +N VLRA M L Sbjct: 238 SARRSRYRKAAHLKELEDQVAQLKAENSCLLRRIAALNQKYNDANVDNRVLRADMETLRA 297 Query: 254 RLQ 262 +++ Sbjct: 298 KVK 300 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,542,086,135 Number of Sequences: 462764 Number of Extensions: 23542086135 Number of Successful Extensions: 219543700 Number of sequences better than 0.0: 0 |