BLASTX 7.6.2 Query= RU22409 /QuerySize=332 (331 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q8LBB2|KING1_ARATH SNF1-related protein kinase regulatory sub... 73 3e-013 >sp|Q8LBB2|KING1_ARATH SNF1-related protein kinase regulatory subunit gamma 1 OS=Arabidopsis thaliana GN=KING1 PE=1 SV=2 Length = 424 Score = 73 bits (178), Expect = 3e-013 Identities = 34/47 (72%), Positives = 40/47 (85%) Frame = +2 Query: 191 WDIQEPQLSPTEKLNACFESVPVSDFPTAPSNQVIEIKSDTSLAQAV 331 WD Q+PQLSP EKLNACFES+PVS FP + +Q IEI+SDTSLA+AV Sbjct: 36 WDEQKPQLSPNEKLNACFESIPVSAFPLSSDSQDIEIRSDTSLAEAV 82 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,542,086,135 Number of Sequences: 462764 Number of Extensions: 23542086135 Number of Successful Extensions: 219543700 Number of sequences better than 0.0: 0 |