BLASTX 7.6.2 Query= RU22458 /QuerySize=187 (186 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9LUV2|POP3_ARATH Putative protein Pop3 OS=Arabidopsis thalia... 85 1e-016 >sp|Q9LUV2|POP3_ARATH Putative protein Pop3 OS=Arabidopsis thaliana GN=At3g17210 PE=1 SV=1 Length = 109 Score = 85 bits (208), Expect = 1e-016 Identities = 38/51 (74%), Positives = 47/51 (92%) Frame = +1 Query: 34 AKGVVKHVVLAKFKEGVSESQIDQLIKGYANLVNLIDPMESFHWGKDLSIE 186 AKG VKHV+LA FK+GVS +I++LIKGYANLVNLI+PM++FHWGKD+SIE Sbjct: 4 AKGPVKHVLLASFKDGVSPEKIEELIKGYANLVNLIEPMKAFHWGKDVSIE 54 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,872,341,632 Number of Sequences: 462764 Number of Extensions: 23872341632 Number of Successful Extensions: 226348076 Number of sequences better than 0.0: 0 |