BLASTX 7.6.2 Query= RU22986 /QuerySize=670 (669 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q53HY2|U737_TOBAC UPF0737 protein mc410 OS=Nicotiana tabacum ... 90 1e-017 >sp|Q53HY2|U737_TOBAC UPF0737 protein mc410 OS=Nicotiana tabacum GN=MC410 PE=2 SV=1 Length = 510 Score = 90 bits (221), Expect = 1e-017 Identities = 47/84 (55%), Positives = 55/84 (65%), Gaps = 2/84 (2%) Frame = +3 Query: 423 NDLSKANGDADTSMNLNGRGVWAAKNNKSDEIEE-RQTDAGNKRKTLFEEMNQQKKHERE 599 N LS N D D S LN G W +++ E+EE R+ D G+KRK LF E +QQKK ERE Sbjct: 76 NLLSSINVDVDASKKLNSGGFWVQNDSRPVEVEEDRRADVGDKRKNLFRESSQQKKQERE 135 Query: 600 AHYTDMHDKTRASHISITED-GST 668 H+ D HDKTR SHISIT D GST Sbjct: 136 GHHADTHDKTRTSHISITTDEGST 159 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,232,428,633 Number of Sequences: 462764 Number of Extensions: 24232428633 Number of Successful Extensions: 234932498 Number of sequences better than 0.0: 0 |