BLASTX 7.6.2 Query= RU23600 /QuerySize=575 (574 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9FK81|Y5258_ARATH Uncharacterized protein At5g22580 OS=Arabi... 136 8e-032 >sp|Q9FK81|Y5258_ARATH Uncharacterized protein At5g22580 OS=Arabidopsis thaliana GN=At5g22580 PE=1 SV=1 Length = 111 Score = 136 bits (342), Expect = 8e-032 Identities = 64/99 (64%), Positives = 75/99 (75%) Frame = +1 Query: 22 FKHLVIVKFKADVVVEEILTGLEKLVAEIDAVKSYEWGQDLESQEMLTQGFTHAILMTFD 201 FKHLV+VKFK D V+EIL GLE LV++ID VKS+EWG+D ES +ML QGFTHA MTF+ Sbjct: 6 FKHLVVVKFKEDTKVDEILKGLENLVSQIDTVKSFEWGEDKESHDMLRQGFTHAFSMTFE 65 Query: 202 KKEDYTLFLSHPKHAEFSGTFSTVIEKIVLLDFPATLVK 318 K+ Y F SHP H EFS F+ VI+KIVLLDFP VK Sbjct: 66 NKDGYVAFTSHPLHVEFSAAFTAVIDKIVLLDFPVAAVK 104 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,307,528,686 Number of Sequences: 462764 Number of Extensions: 25307528686 Number of Successful Extensions: 254258058 Number of sequences better than 0.0: 0 |