BLASTX 7.6.2 Query= RU24478 /QuerySize=250 (249 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9C932|NAC19_ARATH NAC domain-containing protein 19 OS=Arabid... 86 6e-017 sp|Q52QH4|NAC68_ORYSJ NAC domain-containing protein 68 OS=Oryza ... 54 1e-007 sp|Q7F2L3|NAC48_ORYSJ NAC domain-containing protein 48 OS=Oryza ... 50 4e-006 sp|Q39013|NAC2_ARATH NAC domain-containing protein 2 OS=Arabidop... 49 6e-006 sp|Q7EZT1|NAC67_ORYSJ NAC domain-containing protein 67 OS=Oryza ... 49 8e-006 >sp|Q9C932|NAC19_ARATH NAC domain-containing protein 19 OS=Arabidopsis thaliana GN=ANAC PE=1 SV=1 Length = 317 Score = 86 bits (210), Expect = 6e-017 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = +1 Query: 115 MGVPETDPLSQLSLPPGFRFYPTDEELLVQYLCRKVAGYQFNLQI 249 MG+ ETDPL+QLSLPPGFRFYPTDEEL+VQYLCRK AGY F+LQ+ Sbjct: 1 MGIQETDPLTQLSLPPGFRFYPTDEELMVQYLCRKAAGYDFSLQL 45 >sp|Q52QH4|NAC68_ORYSJ NAC domain-containing protein 68 OS=Oryza sativa subsp. japonica GN=NAC68 PE=2 SV=1 Length = 318 Score = 54 bits (129), Expect = 1e-007 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = +1 Query: 118 GVPETDPLSQLSLPPGFRFYPTDEELLVQYLCRKVA 225 G D ++L+LPPGFRF+PTDEEL+V YLCRKVA Sbjct: 9 GSGRRDAEAELNLPPGFRFHPTDEELVVHYLCRKVA 44 >sp|Q7F2L3|NAC48_ORYSJ NAC domain-containing protein 48 OS=Oryza sativa subsp. japonica GN=NAC48 PE=2 SV=1 Length = 303 Score = 50 bits (117), Expect = 4e-006 Identities = 20/27 (74%), Positives = 24/27 (88%) Frame = +1 Query: 148 LSLPPGFRFYPTDEELLVQYLCRKVAG 228 L LPPGFRF+PTDEEL++ YLCR+ AG Sbjct: 7 LQLPPGFRFHPTDEELVMHYLCRRCAG 33 >sp|Q39013|NAC2_ARATH NAC domain-containing protein 2 OS=Arabidopsis thaliana GN=ATAF1 PE=2 SV=2 Length = 289 Score = 49 bits (115), Expect = 6e-006 Identities = 21/34 (61%), Positives = 25/34 (73%) Frame = +1 Query: 148 LSLPPGFRFYPTDEELLVQYLCRKVAGYQFNLQI 249 L LPPGFRF+PTDEEL++ YLCRK A + I Sbjct: 5 LQLPPGFRFHPTDEELVMHYLCRKCASQSIAVPI 38 >sp|Q7EZT1|NAC67_ORYSJ NAC domain-containing protein 67 OS=Oryza sativa subsp. japonica GN=NAC67 PE=2 SV=1 Length = 276 Score = 49 bits (114), Expect = 8e-006 Identities = 20/32 (62%), Positives = 25/32 (78%) Frame = +1 Query: 133 DPLSQLSLPPGFRFYPTDEELLVQYLCRKVAG 228 D + L+LPPGFRF+PTDEEL+ YLC + AG Sbjct: 10 DAEADLNLPPGFRFHPTDEELVAHYLCPRAAG 41 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,639,061,295 Number of Sequences: 462764 Number of Extensions: 27639061295 Number of Successful Extensions: 270866551 Number of sequences better than 0.0: 0 |