BLASTX 7.6.2 Query= RU26877 /QuerySize=450 (449 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9SW27|MUB3_ARATH Membrane-anchored ubiquitin-fold protein 3 ... 57 4e-008 sp|Q7XRU4|MUB4_ORYSJ Membrane-anchored ubiquitin-fold protein 4 ... 51 2e-006 >sp|Q9SW27|MUB3_ARATH Membrane-anchored ubiquitin-fold protein 3 OS=Arabidopsis thaliana GN=MUB3 PE=1 SV=1 Length = 118 Score = 57 bits (135), Expect = 4e-008 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -1 Query: 449 TMIPKTWNEVKLMCFGKILENSKTVGQCKLPFGDV 345 T++PK NEVKL+ GKILEN+KTVGQCK PFGD+ Sbjct: 46 TVVPKGINEVKLISSGKILENNKTVGQCKTPFGDI 80 >sp|Q7XRU4|MUB4_ORYSJ Membrane-anchored ubiquitin-fold protein 4 OS=Oryza sativa subsp. japonica GN=MUB4 PE=2 SV=2 Length = 135 Score = 51 bits (120), Expect = 2e-006 Identities = 21/35 (60%), Positives = 28/35 (80%) Frame = -1 Query: 449 TMIPKTWNEVKLMCFGKILENSKTVGQCKLPFGDV 345 T++PKT N+VKL+ GKILEN K + QC+ PFGD+ Sbjct: 63 TIVPKTANDVKLISGGKILENDKNIAQCRAPFGDL 97 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,987,770,860 Number of Sequences: 462764 Number of Extensions: 30987770860 Number of Successful Extensions: 304546666 Number of sequences better than 0.0: 0 |