BLASTX 7.6.2 Query= RU27749 /QuerySize=496 (495 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q94BU1|Y1181_ARATH Uncharacterized aarF domain-containing pro... 56 8e-008 >sp|Q94BU1|Y1181_ARATH Uncharacterized aarF domain-containing protein kinase At1g71810, chloroplastic OS=Arabidopsis thaliana GN=At1g71810 PE=1 SV=1 Length = 692 Score = 56 bits (134), Expect = 8e-008 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +1 Query: 397 FKVRAAELRQILVELGPAYIKIAQAISSRP 486 FKVRAAELR++LVELGPAY+KIAQA+SSRP Sbjct: 116 FKVRAAELRKLLVELGPAYVKIAQAVSSRP 145 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,987,770,860 Number of Sequences: 462764 Number of Extensions: 30987770860 Number of Successful Extensions: 304546666 Number of sequences better than 0.0: 0 |