BLASTX 7.6.2 Query= RU29099 /QuerySize=191 (190 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glut... 69 6e-012 >sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Length = 1144 Score = 69 bits (167), Expect = 6e-012 Identities = 31/61 (50%), Positives = 43/61 (70%) Frame = -3 Query: 185 IVEVICKRLQPTSYSYAENLVGIYSRLHPVNLLLSVGVNDVRFIGIWGMGGIGKTTMVRA 6 IV+ I +L S SY +N+VGI + L + LL +G+N VR +GIWGMGG+GKTT+ RA Sbjct: 169 IVDQISSKLCKISLSYLQNIVGIDTHLEKIESLLEIGINGVRIMGIWGMGGVGKTTIARA 228 Query: 5 V 3 + Sbjct: 229 I 229 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,987,770,860 Number of Sequences: 462764 Number of Extensions: 30987770860 Number of Successful Extensions: 304546666 Number of sequences better than 0.0: 0 |