BLASTX 7.6.2 Query= RU31440 /QuerySize=223 (222 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|O23305|Y4449_ARATH FHA domain-containing protein At4g14490 OS... 80 2e-015 >sp|O23305|Y4449_ARATH FHA domain-containing protein At4g14490 OS=Arabidopsis thaliana GN=At4g14490 PE=1 SV=1 Length = 386 Score = 80 bits (197), Expect = 2e-015 Identities = 34/58 (58%), Positives = 48/58 (82%) Frame = -2 Query: 176 ALKLEMLKGPREGETLEYRPRSKVRIGRVVRGNNLAIKDSGISTNHLIIDFESGKWMI 3 +L+L +KGPREG+ L+Y+P S +R+GR+VRGN +AIKD+GIST HL I+ +SG W+I Sbjct: 5 SLRLVFVKGPREGDALDYKPGSTIRVGRIVRGNEIAIKDAGISTKHLRIESDSGNWVI 62 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,867,139,694 Number of Sequences: 462764 Number of Extensions: 32867139694 Number of Successful Extensions: 314845248 Number of sequences better than 0.0: 0 |