BLASTX 7.6.2 Query= RU31985 /QuerySize=249 (248 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like pro... 55 7e-008 >sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=2 SV=1 Length = 1054 Score = 55 bits (132), Expect = 7e-008 Identities = 24/51 (47%), Positives = 39/51 (76%), Gaps = 1/51 (1%) Frame = +3 Query: 96 IPSTSLVDESSIIARGSDKEKIIQMVLSEQGEGGGNVSVIPIVGMGGIGKT 248 +P+TSLVDES + R DK++I++ ++ E G+ G ++V+ IVG+GG+GKT Sbjct: 161 LPTTSLVDESEVFGRDDDKDEIMRFLIPENGKDNG-ITVVAIVGIGGVGKT 210 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,867,139,694 Number of Sequences: 462764 Number of Extensions: 32867139694 Number of Successful Extensions: 314845248 Number of sequences better than 0.0: 0 |