BLASTX 7.6.2 Query= RU33297 /QuerySize=133 (132 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q7LBC6|JHD2B_HUMAN JmjC domain-containing histone demethylati... 49 7e-006 sp|Q6ZPY7|JHD2B_MOUSE JmjC domain-containing histone demethylati... 49 9e-006 >sp|Q7LBC6|JHD2B_HUMAN JmjC domain-containing histone demethylation protein 2B OS=Homo sapiens GN=JMJD1B PE=1 SV=1 Length = 1761 Score = 49 bits (115), Expect = 7e-006 Identities = 21/36 (58%), Positives = 27/36 (75%) Frame = -1 Query: 126 KKQLKEEFDVEPWTFEQHLGEAVFIPAGCPHQVQSL 19 +K+L EE+ V+ W Q LG+AVFIPAG PHQV +L Sbjct: 1659 RKRLYEEYGVQGWAIVQFLGDAVFIPAGAPHQVHNL 1694 >sp|Q6ZPY7|JHD2B_MOUSE JmjC domain-containing histone demethylation protein 2B OS=Mus musculus GN=Jmjd1b PE=2 SV=2 Length = 1562 Score = 49 bits (114), Expect = 9e-006 Identities = 21/36 (58%), Positives = 27/36 (75%) Frame = -1 Query: 126 KKQLKEEFDVEPWTFEQHLGEAVFIPAGCPHQVQSL 19 +K+L EE+ V+ W Q LG+AVFIPAG PHQV +L Sbjct: 1460 RKRLFEEYGVQGWAIVQFLGDAVFIPAGAPHQVHNL 1495 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,867,139,694 Number of Sequences: 462764 Number of Extensions: 32867139694 Number of Successful Extensions: 314845248 Number of sequences better than 0.0: 0 |