BLASTX 7.6.2 Query= RU33683 /QuerySize=201 (200 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|P29675|SF3_HELAN Pollen-specific protein SF3 OS=Helianthus an... 97 3e-020 >sp|P29675|SF3_HELAN Pollen-specific protein SF3 OS=Helianthus annuus GN=SF3 PE=2 SV=1 Length = 219 Score = 97 bits (239), Expect = 3e-020 Identities = 40/47 (85%), Positives = 42/47 (89%) Frame = -2 Query: 199 YHKMCFKCTHGGCTISPSNYIAHEGRLYCKHHHTQLIKEKGNLSQLE 59 YH+ CFKC HGGCTISPSNYIAHEGRLYCKHHH QL K+KGN SQLE Sbjct: 130 YHRACFKCCHGGCTISPSNYIAHEGRLYCKHHHIQLFKKKGNYSQLE 176 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,867,139,694 Number of Sequences: 462764 Number of Extensions: 32867139694 Number of Successful Extensions: 314845248 Number of sequences better than 0.0: 0 |