BLASTX 7.6.2 Query= RU34083 /QuerySize=181 (180 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS... 61 1e-009 sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS... 60 3e-009 sp|Q9SX38|DRL4_ARATH Putative disease resistance protein At1g501... 49 7e-006 sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like pro... 49 7e-006 >sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Length = 992 Score = 61 bits (147), Expect = 1e-009 Identities = 28/57 (49%), Positives = 38/57 (66%) Frame = -1 Query: 174 LESLGKDIVKRCKGLPLLAKVLGGLMRSKKTKKEWQDVLSSKIWGLDKVEQQVFRPL 4 L +GK+IVK+C G+PL AK LGGL+R K+ + EW+ V S+IW L + E V L Sbjct: 335 LMEIGKEIVKKCGGVPLAAKTLGGLLRFKREESEWEHVRDSEIWNLPQDENSVLPAL 391 >sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Length = 988 Score = 60 bits (144), Expect = 3e-009 Identities = 26/57 (45%), Positives = 39/57 (68%) Frame = -1 Query: 174 LESLGKDIVKRCKGLPLLAKVLGGLMRSKKTKKEWQDVLSSKIWGLDKVEQQVFRPL 4 L ++GK+IVK+C G+PL AK LGGL+R K+ + EW+ V ++IW L + E + L Sbjct: 337 LVAIGKEIVKKCGGVPLAAKTLGGLLRFKREESEWEHVRDNEIWSLPQDESSILPAL 393 >sp|Q9SX38|DRL4_ARATH Putative disease resistance protein At1g50180 OS=Arabidopsis thaliana GN=At1g50180 PE=2 SV=1 Length = 839 Score = 49 bits (115), Expect = 7e-006 Identities = 23/40 (57%), Positives = 27/40 (67%) Frame = -1 Query: 180 KVLESLGKDIVKRCKGLPLLAKVLGGLMRSKKTKKEWQDV 61 K +E +GK IV RC GLPL VLGGL+ +K T EWQ V Sbjct: 349 KKMEEIGKQIVVRCGGLPLAITVLGGLLATKSTWNEWQRV 388 >sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=2 SV=1 Length = 1054 Score = 49 bits (115), Expect = 7e-006 Identities = 22/43 (51%), Positives = 30/43 (69%) Frame = -1 Query: 165 LGKDIVKRCKGLPLLAKVLGGLMRSKKTKKEWQDVLSSKIWGL 37 L + IV +C+GLPL K LGG++R + EW+ VLSS+IW L Sbjct: 362 LAERIVHKCRGLPLAVKTLGGVLRFEGKVIEWERVLSSRIWDL 404 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,867,139,694 Number of Sequences: 462764 Number of Extensions: 32867139694 Number of Successful Extensions: 314845248 Number of sequences better than 0.0: 0 |