BLASTX 7.6.2 Query= RU35315 /QuerySize=230 (229 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like pro... 60 2e-009 sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS... 54 3e-007 sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum ... 52 8e-007 sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14... 50 4e-006 >sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=2 SV=1 Length = 1054 Score = 60 bits (145), Expect = 2e-009 Identities = 26/51 (50%), Positives = 36/51 (70%) Frame = +3 Query: 75 KTTLAQFVYNDVRVKQHFELQAWVCISEEFDVFGICQHIYESLTSEACQST 227 KTTL+Q +YND V+ +F + W +SEEFDVF I + +YES+TS C+ T Sbjct: 209 KTTLSQLLYNDQHVRSYFGTKVWAHVSEEFDVFKITKKVYESVTSRPCEFT 259 >sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Length = 992 Score = 54 bits (127), Expect = 3e-007 Identities = 22/47 (46%), Positives = 34/47 (72%) Frame = +3 Query: 75 KTTLAQFVYNDVRVKQHFELQAWVCISEEFDVFGICQHIYESLTSEA 215 KTTLAQ V+ND R+ +HF L+ WVC+S++FD + + I ES+ ++ Sbjct: 188 KTTLAQMVFNDQRITEHFNLKIWVCVSDDFDEKRLIKAIVESIEGKS 234 >sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Length = 970 Score = 52 bits (123), Expect = 8e-007 Identities = 22/43 (51%), Positives = 31/43 (72%) Frame = +3 Query: 75 KTTLAQFVYNDVRVKQHFELQAWVCISEEFDVFGICQHIYESL 203 KTTLAQ V+ND RV +HF + W+C+SE+FD + + I ES+ Sbjct: 188 KTTLAQMVFNDQRVTEHFHSKIWICVSEDFDEKRLIKAIVESI 230 >sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=2 SV=1 Length = 1424 Score = 50 bits (117), Expect = 4e-006 Identities = 25/71 (35%), Positives = 38/71 (53%), Gaps = 1/71 (1%) Frame = +3 Query: 6 LLSDDETG-NEXXXXXXXXXXXXXKTTLAQFVYNDVRVKQHFELQAWVCISEEFDVFGIC 182 LLSDDE + KTTL + V+ND RV +HFE++ W+ F+VF + Sbjct: 182 LLSDDEISIGKPAVISVVGMPGVGKTTLTEIVFNDYRVTEHFEVKMWISAGINFNVFTVT 241 Query: 183 QHIYESLTSEA 215 + + + +TS A Sbjct: 242 KAVLQDITSSA 252 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,541,198,186 Number of Sequences: 462764 Number of Extensions: 33541198186 Number of Successful Extensions: 329270993 Number of sequences better than 0.0: 0 |