BLASTX 7.6.2 Query= RU39836 /QuerySize=236 (235 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q1PFD1|BLH11_ARATH BEL1-like homeodomain protein 11 OS=Arabid... 63 4e-010 >sp|Q1PFD1|BLH11_ARATH BEL1-like homeodomain protein 11 OS=Arabidopsis thaliana GN=BLH11 PE=2 SV=1 Length = 290 Score = 63 bits (151), Expect = 4e-010 Identities = 38/81 (46%), Positives = 52/81 (64%), Gaps = 11/81 (13%) Frame = -3 Query: 233 MSRHFGSLRDAIMSHIYAEKRKLM---QDFPK-VSGGLAQLSLFDRECRQKRMSLQQLGI 66 M+RHFGSL +AI+S + + +R+ + QD PK +S GL+QLSLFD SLQ+LG+ Sbjct: 137 MTRHFGSLEEAIISQLNSVRRRFIISHQDVPKIISSGLSQLSLFDGNTTSS--SLQRLGL 194 Query: 65 NTNKEPKRNKRQAWRPIRGLP 3 + R AW+PIRGLP Sbjct: 195 VQGPQ-----RHAWKPIRGLP 210 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,778,694,167 Number of Sequences: 462764 Number of Extensions: 35778694167 Number of Successful Extensions: 346783611 Number of sequences better than 0.0: 0 |