BLASTX 7.6.2 Query= RU40470 /QuerySize=227 (226 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q94BT6|ADO1_ARATH Adagio protein 1 OS=Arabidopsis thaliana GN... 57 3e-008 sp|Q8W420|ADO2_ARATH Adagio protein 2 OS=Arabidopsis thaliana GN... 50 4e-006 >sp|Q94BT6|ADO1_ARATH Adagio protein 1 OS=Arabidopsis thaliana GN=ADO1 PE=1 SV=2 Length = 609 Score = 57 bits (135), Expect = 3e-008 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -1 Query: 94 VENLLQTAPCGIVVTDAIDPDHPIIYVNTVF 2 V NLL TAPCG VVTDA++PD PIIYVNTVF Sbjct: 36 VGNLLHTAPCGFVVTDAVEPDQPIIYVNTVF 66 >sp|Q8W420|ADO2_ARATH Adagio protein 2 OS=Arabidopsis thaliana GN=ADO2 PE=1 SV=1 Length = 611 Score = 50 bits (117), Expect = 4e-006 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -1 Query: 94 VENLLQTAPCGIVVTDAIDPDHPIIYVNTVF 2 V +L TAPCG VV+DA++PD+PIIYVNTVF Sbjct: 36 VGSLPGTAPCGFVVSDALEPDNPIIYVNTVF 66 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,676,510,624 Number of Sequences: 462764 Number of Extensions: 37676510624 Number of Successful Extensions: 356613605 Number of sequences better than 0.0: 0 |