BLASTX 7.6.2 Query= RU44479 /QuerySize=420 (419 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9SB61|Y4466_ARATH ZF-HD homeobox protein At4g24660 OS=Arabid... 58 1e-008 sp|Q9FKP8|Y5541_ARATH ZF-HD homeobox protein At5g65410 OS=Arabid... 57 1e-008 >sp|Q9SB61|Y4466_ARATH ZF-HD homeobox protein At4g24660 OS=Arabidopsis thaliana GN=At4g24660 PE=1 SV=1 Length = 220 Score = 58 bits (138), Expect = 1e-008 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +1 Query: 307 KRFRTKFTPEQKVRMVEFAERVGWRIQKQDEEDVEKF 417 KRFRTKFT EQK +M+ FAER+GWRIQK D+ VE+F Sbjct: 158 KRFRTKFTAEQKEKMLAFAERLGWRIQKHDDVAVEQF 194 >sp|Q9FKP8|Y5541_ARATH ZF-HD homeobox protein At5g65410 OS=Arabidopsis thaliana GN=At5g65410 PE=1 SV=1 Length = 279 Score = 57 bits (137), Expect = 1e-008 Identities = 24/38 (63%), Positives = 32/38 (84%) Frame = +1 Query: 304 KKRFRTKFTPEQKVRMVEFAERVGWRIQKQDEEDVEKF 417 +KR RTKFT EQK RM+ AER+GWRIQ+QD+E +++F Sbjct: 191 RKRHRTKFTAEQKERMLALAERIGWRIQRQDDEVIQRF 228 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,621,414,376 Number of Sequences: 462764 Number of Extensions: 39621414376 Number of Successful Extensions: 367225502 Number of sequences better than 0.0: 0 |