BLASTX 7.6.2 Query= RU45054 /QuerySize=406 (405 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|P50651|RIR2A_ARATH Ribonucleoside-diphosphate reductase small... 55 7e-008 sp|Q60561|RIR2_MESAU Ribonucleoside-diphosphate reductase subuni... 49 4e-006 sp|P11157|RIR2_MOUSE Ribonucleoside-diphosphate reductase subuni... 49 4e-006 sp|Q4KLN6|RIR2_RAT Ribonucleoside-diphosphate reductase subunit ... 49 4e-006 >sp|P50651|RIR2A_ARATH Ribonucleoside-diphosphate reductase small chain A OS=Arabidopsis thaliana GN=RNR2A PE=1 SV=2 Length = 341 Score = 55 bits (131), Expect = 7e-008 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +3 Query: 285 FASSEEVDLSQDVQLWEALIDSKKHFISHVLAF 383 F ++EEVDLS DVQ WEAL DS+KHFISH+LAF Sbjct: 50 FWTAEEVDLSTDVQQWEALTDSEKHFISHILAF 82 >sp|Q60561|RIR2_MESAU Ribonucleoside-diphosphate reductase subunit M2 OS=Mesocricetus auratus GN=RRM2 PE=2 SV=1 Length = 386 Score = 49 bits (116), Expect = 4e-006 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = +3 Query: 285 FASSEEVDLSQDVQLWEALIDSKKHFISHVLAF 383 F ++EEVDLS+D+Q WEAL ++HFISHVLAF Sbjct: 102 FWTAEEVDLSKDIQHWEALKPDERHFISHVLAF 134 >sp|P11157|RIR2_MOUSE Ribonucleoside-diphosphate reductase subunit M2 OS=Mus musculus GN=Rrm2 PE=1 SV=1 Length = 390 Score = 49 bits (116), Expect = 4e-006 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = +3 Query: 285 FASSEEVDLSQDVQLWEALIDSKKHFISHVLAF 383 F ++EEVDLS+D+Q WEAL ++HFISHVLAF Sbjct: 102 FWTAEEVDLSKDIQHWEALKPDERHFISHVLAF 134 >sp|Q4KLN6|RIR2_RAT Ribonucleoside-diphosphate reductase subunit M2 OS=Rattus norvegicus GN=Rrm2 PE=2 SV=1 Length = 390 Score = 49 bits (116), Expect = 4e-006 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = +3 Query: 285 FASSEEVDLSQDVQLWEALIDSKKHFISHVLAF 383 F ++EEVDLS+D+Q WEAL ++HFISHVLAF Sbjct: 102 FWTAEEVDLSKDIQHWEALKPDERHFISHVLAF 134 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,621,414,376 Number of Sequences: 462764 Number of Extensions: 39621414376 Number of Successful Extensions: 367225502 Number of sequences better than 0.0: 0 |