BLASTX 7.6.2 Query= RU47215 /QuerySize=239 (238 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|O23969|SF21_HELAN Pollen-specific protein SF21 OS=Helianthus ... 84 2e-016 >sp|O23969|SF21_HELAN Pollen-specific protein SF21 OS=Helianthus annuus GN=SF21 PE=2 SV=1 Length = 352 Score = 84 bits (205), Expect = 2e-016 Identities = 39/56 (69%), Positives = 46/56 (82%) Frame = +2 Query: 68 GGKECVVKTSRGSVSVFVCGDQGKPALITYPDVALNYTSCFQGLFFCSDAASLLLH 235 GGKE +++T GSVSV VCGDQ KP LITYPD+ALN+ SCFQGLF ++ASLLLH Sbjct: 18 GGKEHIIRTGCGSVSVTVCGDQEKPPLITYPDLALNHMSCFQGLFVSPESASLLLH 73 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,621,414,376 Number of Sequences: 462764 Number of Extensions: 39621414376 Number of Successful Extensions: 367225502 Number of sequences better than 0.0: 0 |