BLASTX 7.6.2 Query= RU50217 /QuerySize=241 (240 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q944L7|Y1480_ARATH Uncharacterized protein At1g18480 OS=Arabi... 70 3e-012 >sp|Q944L7|Y1480_ARATH Uncharacterized protein At1g18480 OS=Arabidopsis thaliana GN=At1g18480 PE=2 SV=1 Length = 391 Score = 70 bits (169), Expect = 3e-012 Identities = 29/46 (63%), Positives = 40/46 (86%) Frame = -2 Query: 140 DRLIAIGDVHGDLDKTKQSLRLANLIDQSDKWVGGSATVVQVGDVL 3 +RL+AIGD+HGDL+K++++ ++A LID SD+W GGS VVQVGDVL Sbjct: 54 ERLVAIGDLHGDLEKSREAFKIAGLIDSSDRWTGGSTMVVQVGDVL 99 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,561,515,216 Number of Sequences: 462764 Number of Extensions: 42561515216 Number of Successful Extensions: 398959678 Number of sequences better than 0.0: 0 |