BLASTX 7.6.2 Query= RU55207 /QuerySize=247 (246 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|P33543|TMKL1_ARATH Putative kinase-like protein TMKL1 OS=Arab... 50 2e-006 >sp|P33543|TMKL1_ARATH Putative kinase-like protein TMKL1 OS=Arabidopsis thaliana GN=TMKL1 PE=2 SV=1 Length = 674 Score = 50 bits (119), Expect = 2e-006 Identities = 22/31 (70%), Positives = 30/31 (96%) Frame = +1 Query: 151 DVELLLGNIKASLQGNAQNLLLTSWNTSLPV 243 DV+LLLG IK+SLQGN+++LLL+SWN+S+PV Sbjct: 32 DVKLLLGKIKSSLQGNSESLLLSSWNSSVPV 62 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,470,057,025 Number of Sequences: 462764 Number of Extensions: 44470057025 Number of Successful Extensions: 408778528 Number of sequences better than 0.0: 0 |