BLASTX 7.6.2 Query= RU00146 /QuerySize=295 (294 letters) Database: UniProt/TrEMBL; 7,695,149 sequences; 2,506,224,640 total letters Score E Sequences producing significant alignments: (bits) Value tr|A7PU44|A7PU44_VITVI Chromosome chr7 scaffold_31, whole genome... 70 4e-011 tr|B9SFN4|B9SFN4_RICCO Synapse-associated protein, putative OS=R... 68 2e-010 tr|B9HMA3|B9HMA3_POPTR Predicted protein OS=Populus trichocarpa ... 63 5e-009 tr|Q9ZVT6|Q9ZVT6_ARATH F15K9.5 protein OS=Arabidopsis thaliana G... 59 9e-008 tr|Q8LE33|Q8LE33_ARATH Putative uncharacterized protein OS=Arabi... 57 4e-007 tr|B9RSU4|B9RSU4_RICCO Synapse-associated protein, putative OS=R... 55 2e-006 tr|Q0WTY5|Q0WTY5_ARATH Putative uncharacterized protein At4g1311... 53 5e-006 tr|Q9SV58|Q9SV58_ARATH Putative uncharacterized protein AT4g1311... 53 5e-006 >tr|A7PU44|A7PU44_VITVI Chromosome chr7 scaffold_31, whole genome shotgun sequence OS=Vitis vinifera GN=GSVIVT00023651001 PE=4 SV=1 Length = 334 Score = 70 bits (170), Expect = 4e-011 Identities = 30/53 (56%), Positives = 41/53 (77%) Frame = -1 Query: 162 MNTYLEEPEDLESYGEWKLGFVLEEKAEETENLMKENGVIGEIHEEIVPGEVD 4 +NTY+EEPEDL+ Y +WKL FVL++K EE +NL++ENG + I+ IVP VD Sbjct: 54 VNTYVEEPEDLDDYNKWKLEFVLDDKGEEIQNLLEENGAMEGIYNRIVPKNVD 106 >tr|B9SFN4|B9SFN4_RICCO Synapse-associated protein, putative OS=Ricinus communis GN=RCOM_0647910 PE=4 SV=1 Length = 433 Score = 68 bits (164), Expect = 2e-010 Identities = 29/53 (54%), Positives = 41/53 (77%) Frame = -1 Query: 162 MNTYLEEPEDLESYGEWKLGFVLEEKAEETENLMKENGVIGEIHEEIVPGEVD 4 ++TY EEPEDL+ Y +WKLGFVLEEK E+ E+L++EN I +++ +VP VD Sbjct: 165 VSTYCEEPEDLDDYKKWKLGFVLEEKREDFESLIRENSAIESVYKRVVPTGVD 217 >tr|B9HMA3|B9HMA3_POPTR Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_872490 PE=4 SV=1 Length = 358 Score = 63 bits (152), Expect = 5e-009 Identities = 30/54 (55%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Frame = -1 Query: 159 NTYLEEPEDLESYGEWK-LGFVLEEKAEETENLMKENGVIGEIHEEIVPGEVDN 1 +TY EPED E Y +WK GFV++EK EE E + ENGVI EI+ E+VP VD+ Sbjct: 171 DTYCSEPEDKEDYEKWKSRGFVIDEKKEEIERFISENGVIREIYGEVVPNRVDD 224 >tr|Q9ZVT6|Q9ZVT6_ARATH F15K9.5 protein OS=Arabidopsis thaliana GN=At1g03350 PE=2 SV=1 Length = 470 Score = 59 bits (141), Expect = 9e-008 Identities = 25/54 (46%), Positives = 38/54 (70%) Frame = -1 Query: 162 MNTYLEEPEDLESYGEWKLGFVLEEKAEETENLMKENGVIGEIHEEIVPGEVDN 1 +NTY EEPED + Y +W+ F L+ KAEE E L++ENG + +++ +VP VD+ Sbjct: 163 LNTYCEEPEDSDDYKKWESAFSLDGKAEEMEKLLEENGDMKGVYKRVVPSMVDH 216 >tr|Q8LE33|Q8LE33_ARATH Putative uncharacterized protein OS=Arabidopsis thaliana PE=2 SV=1 Length = 315 Score = 57 bits (135), Expect = 4e-007 Identities = 25/51 (49%), Positives = 34/51 (66%) Frame = -1 Query: 156 TYLEEPEDLESYGEWKLGFVLEEKAEETENLMKENGVIGEIHEEIVPGEVD 4 T++ EP+DL + W LGF LEEK E L+ N V+ EI+EEIVP ++D Sbjct: 143 TFVREPDDLSDFENWSLGFKLEEKRNEIVELINGNKVVKEIYEEIVPVDID 193 >tr|B9RSU4|B9RSU4_RICCO Synapse-associated protein, putative OS=Ricinus communis GN=RCOM_0678570 PE=4 SV=1 Length = 454 Score = 55 bits (130), Expect = 2e-006 Identities = 27/55 (49%), Positives = 35/55 (63%), Gaps = 1/55 (1%) Frame = -1 Query: 162 MNTYLEEPEDLESYGEWKLGFV-LEEKAEETENLMKENGVIGEIHEEIVPGEVDN 1 +NTY EPED Y W LGF LEEK E ++L+ EN V+ E + E+VP VD+ Sbjct: 167 LNTYCNEPEDKVEYENWILGFFDLEEKKLEIDSLLGENRVVEEFYNELVPSRVDS 221 >tr|Q0WTY5|Q0WTY5_ARATH Putative uncharacterized protein At4g13110 (Fragment) OS=Arabidopsis thaliana GN=At4g13110 PE=2 SV=1 Length = 302 Score = 53 bits (126), Expect = 5e-006 Identities = 25/51 (49%), Positives = 32/51 (62%) Frame = -1 Query: 156 TYLEEPEDLESYGEWKLGFVLEEKAEETENLMKENGVIGEIHEEIVPGEVD 4 T++ EP+DL + W LG LEEK E L+ N + EI+EEIVP EVD Sbjct: 130 TFVREPDDLSDFENWSLGLKLEEKRNEIVELINGNKGVKEIYEEIVPVEVD 180 >tr|Q9SV58|Q9SV58_ARATH Putative uncharacterized protein AT4g13110 OS=Arabidopsis thaliana GN=AT4g13110 PE=4 SV=1 Length = 365 Score = 53 bits (126), Expect = 5e-006 Identities = 25/51 (49%), Positives = 32/51 (62%) Frame = -1 Query: 156 TYLEEPEDLESYGEWKLGFVLEEKAEETENLMKENGVIGEIHEEIVPGEVD 4 T++ EP+DL + W LG LEEK E L+ N + EI+EEIVP EVD Sbjct: 193 TFVREPDDLSDFENWSLGLKLEEKRNEIVELINGNKGVKEIYEEIVPVEVD 243 Database: UniProt/TrEMBL Posted date: Sun May 10 14:41:50 2009 Number of letters in database: 2,506,224,640 Number of sequences in database: 7,695,149 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,069,392,446 Number of Sequences: 7695149 Number of Extensions: 5069392446 Number of Successful Extensions: 8688323 Number of sequences better than 0.0: 0 |